Recombinant Mouse Platelet-derived growth factor subunit B (Pdgfb) (Active)

In Stock
Code: CSB-AP004141MO
Size:
10ug
10ug50ug500ug1mg
US$204
Quantity:
Express system: E.coli
Species: Mus musculus (Mouse)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Mouse Pdgfb protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using Balb/c3T3 mouse fibroblast cells is 1.55 ng/ml.
Target Names
Pdgfb
Uniprot NO.
Research Area
Cancer
Alternative Names
Pdgfb; SisPlatelet-derived growth factor subunit B; PDGF subunit B; PDGF-2; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; Proto-oncogene c-Sis
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
82-190aa
Target Protein Sequence
SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVVTPRPVT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
13.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm Filtered 4 mM HCl
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

PDGF-BB is a potent mitogen central to tumor microenvironment remodeling, angiogenesis, and stromal cell recruitment, making it a critical tool for in vivo tumor biology models and receptor-ligand interaction studies. This recombinant mouse PDGF-B subunit, covering the full-length mature protein (aa 82–190) with a C-terminal 6xHis tag, demonstrates strong receptor-binding potency with an ED50 of 1.55 ng/mL in Balb/c 3T3 fibroblast proliferation assays, confirming its suitability for cell proliferation and survival experiments as well as PDGFRβ competition binding assays via SPR or ELISA. Expressed in *E. coli*, the protein lacks glycosylation—an advantage for studies requiring homogeneous, non-glycosylated ligand to isolate receptor-binding kinetics from carbohydrate-mediated effects. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for sensitive cell-based differentiation studies and antibody characterization workflows.

Customer Reviews and Q&A

 Customer Reviews

Target Background

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products