Recombinant Human Platelet-derived growth factor subunit A (PDGFA) (Active)

In Stock Discontinued
Code: CSB-AP003921HU
Size:
10μg
10μg50μg500μg1mg(1mg*1 or 500ug*2)
US$195
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 300 ng/ml.
Target Names
PDGFA
Uniprot NO.
Research Area
Cancer
Alternative Names
PDGF A; PDGF A chain; PDGF subunit A; PDGF-1; PDGF1; PDGFA; PDGFA_HUMAN; Platelet derived growth factor alpha chain; Platelet derived growth factor alpha isoform 2 preproprotein; Platelet derived growth factor alpha polypeptide ; Platelet-derived growth factor A chain; Platelet-derived growth factor alpha polypeptide; Platelet-derived growth factor subunit A
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
87-211aa
Target Protein Sequence
SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered solution of 4mM HCL
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis. Required for normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFB.
Gene References into Functions
  1. High PDGF expression is associated with cardiac fibrosis. PMID:30340644
  2. Hypomethylation at a CpG site in PDGFA (encoding platelet-derived growth factor alpha) and PDGFA overexpression are both associated with increased T2 diabetes risk, hyperinsulinemia, increased insulin resistance, and increased steatohepatitis risk. PMID:29728363
  3. PDGFA was down-regulated in the malignant Middle Cerebral Artery Infarction. PMID:28828208
  4. this study uncovers a novel mechanism of the Nrf2/PDGFA regulatory loop that is crucial for AKT-dependent hepatocellular carcinoma progression PMID:27588483
  5. Tumor cell induced mesenchymal stromal cell chemotaxis appears to be mediated through paracrine secretion of PDGF-AA. PMID:27931212
  6. PDGFAA in tumor drainage and HER2 in peripheral vein blood may have roles in synchronous liver metastasis of colorectal cancer PMID:28275303
  7. Insulin treatment caused sustained Akt activity, whereas EGF or PDGF-AA promoted transient signaling; PDGF-BB produced sustained responses at higher concentrations.Transient responses to EGF were caused by negative feedback at the receptor level, as a second treatment yielded minimal responses, whereas parallel exposure to IGF-I caused full Akt activation PMID:27044757
  8. these findings suggest that IGFBP-3 suppresses transcription of EGR1 and its target genes bFGF and PDGF through inhibiting IGF-1-dependent ERK and AKT activation. PMID:27521890
  9. Based on a luciferase reporter assay, plateletderived growth factorA (PDGFA) was identified as a direct target gene of miR375. Additionally, overexpression of PDGFA significantly reversed the effect of miR375 on cell migration and invasion in oral squamous cell carcinoma cell. PMID:28000902
  10. The highest PDGF AA levels were found in mothers of fetuses with hypoplastic left heart syndrome . These findings may be useful in screening for congenital heart defects (CCHDs) and offer insight into their association with nuchal translucency PMID:28323386
  11. Low concentration of PDGF-AB showed synergism with IFN-alpha in IFN-beta and -gamma induction. PMID:24063997
  12. downregulated Rab5a led to slowed cell growth, decreased numbers of migrated cells, decreased numbers of cells at the G0G1 phase and a higher apoptosis rate. However, PDGF significantly rescued these phenomena caused by siRNA against Rab5a PMID:27666726
  13. There are four platelet-derived growth factor (PDGF) genes (PDGFA, PDGFB, PDGFC and PDGFD) that reside on chromosomes 7, 22, 4 and 11. PMID:28267575
  14. TLR-stimulated pancreatic cancer cells were specifically investigated for activated signaling pathways of VEGF/PDGF and anti-apoptotic Bcl-xL expression as well as tumor cell growth. PMID:27941651
  15. Nox4 and Duox1/Duox2 mediate redox activation of mesenchymal cell migration by PDGF. PMID:27110716
  16. In contrast to platelet-derived growth factor, all urokinase isoforms induced secretion of MMP-9 by mesenchymal stromal cells. PMID:27783304
  17. Normalization of bone marrow microenvironment is paralleled by decreased expression of TIMP and PDGFA. PMID:26708839
  18. in primary cultures of glioma stemlike cells that EGR1 contributes to stemness marker expression and proliferation by orchestrating a PDGFA-dependent growth-stimulatory loop. PMID:27002148
  19. These findings implicate DNA hypomethylation as a specific factor in mediating overexpression of genes associated with Biliary Atresia (BA) and identify PDGFA as a new candidate in BA pathogenesis. PMID:27010479
  20. Human uPAR activation and its association with beta1-integrin are required for PDGF-AB-induced migration. PMID:26420039
  21. PDGF-AA impairs endothelium-dependent vasodilation and PDGF-AA mediates BMP4-induced adverse effect on endothelial cell function through SMAD1/5- and SMAD4-dependent mechanisms. PMID:26769046
  22. The development and severity of age-related cataracts was related to the secretion and expression of PDGF-alpha. PMID:26535645
  23. PDGF and TGFbeta1 regulate acute respiratory distress syndrome-associated lung fibrosis through distinct signaling pathway-mediated activation of fibrosis-related proteins. PMID:26088859
  24. Demonstrate a novel positive regulatory feedback loop between FoxM1 and the PDGF-A/AKT signaling pathway, which contributes to breast cancer cell growth and tumorigenesis. PMID:25869208
  25. There was evidence for the involvement of PDGF, IGF-1, and EGF in primary pulmonary hypoplasia. PDGF deficiency plays a certain role in secondary pulmonary hypoplasia PMID:26841646
  26. MIC-1 and PDGF-A expression is elevated in both prostate tumors and structurally intact adjacent tissues. PMID:25767870
  27. review elucidates the role of tumor stroma interactions, the roles of PDGF receptor signaling in cancer-associated fibroblasts via alteration of stromal matrix composition and the mitogenic effects of cancer-derived PDGFs. PMID:23944365
  28. Silencing the Col4-alpha1 gene or disrupting integrin engagement by blocking the antibody reduced the expression of platelet-derived growth factor A (PDGF-A), a potent chemotactic factor for fibroblasts. PMID:25686533
  29. our findings showed how FoxM1 activates expression of PDGF-A and STAT3 in a pathway required to maintain the self-renewal and tumorigenicity of glioma stem-like cells. PMID:25832656
  30. Patients with Graves ophthalmopathy had significantly higher serum levels of PDGF-AA than controls. Immunosuppressive therapy removed differences. PMID:25140996
  31. AVP stimulates myofibroblast proliferation and induces PDGFA secretion, implying that PDGFA mediates local myofibroblast proliferation by an autocrine feedback loop and regulates epithelial proliferation and permeability by a paracrine mechanism. PMID:25085844
  32. VEGF, PDGF, and TGF-beta1 concentrations in platelets may be associated with prognosis of breast cancer. PMID:25379550
  33. both VEGF and PDGF were significantly downregulated after completing a full CMP rush IgE desensitization. PMID:24995287
  34. PDGFA is a SOX11 direct target gene upregulated in MCL cells whose inhibition impaired SOX11-enhanced in vitro angiogenic effects on endothelial cells PMID:25092176
  35. demonstrated that PDGFRA activation supported tumor cell proliferation PMID:24480986
  36. PDGF positively modulates the TGF-beta-induced osteogenic differentiation of hMSCs through synergistic crosstalk between MEK- and PI3K/Akt-mediated signaling PMID:24378341
  37. The suppressive effects of PDGF-BB on Ca(2+) overload in neurons were more potent than those of PDGF-AA. PMID:24454980
  38. The mRNA expressions of the proangiogenic growth factors VEGF, PDGF, bFGF and their receptors (VEGFR1, VEGFR2, PDGFRA, PDGFRB, FGFR1, FGFR2) were measured and compared in gastric ulcers of cirrhotic patients. PMID:23620752
  39. our studies establish that loss of SMAD1/5 leads to upregulation of PDGFA in ovarian granulosa cells PMID:22964636
  40. Platelet-derived growth factor-A and vascular endothelial growth factor-C might induce intimal proliferation in pulmonary arteries and contribute to the development of pulmonary tumor thrombotic microangiopathy. PMID:23536282
  41. show that VEGF was down-regulated while platelet-derived growth factor-A (PDGF-A) was up-regulated when IFN-alpha treatment was re-initiated. PMID:23025904
  42. Findings suggest a role for brain derived neurotropic factor (BDNF) and platelet derived growth factors PDGF-AA in the patho-physiological mechanism of cerebrovascular disease in sickle cell anemia (SCA). PMID:22704695
  43. Results suggest that PDGFA may be used for cholangiocarcinoma prognosis and/or as diagnostic candidate marker. PMID:22733151
  44. Pdgf signaling potentiates Wnt2-Wnt7b signaling to promote high levels of Wnt activity in mesenchymal progenitors that is required for proper development of endoderm-derived organs, such as the lung PMID:22949635
  45. Significant positive correlation was seen between serum PDGF-AB & microvascular density in multiple myeloma, & between pre- & post-treatment patients. PDGF-AB plays a role in a complex cytokine network inducing bone marrow neovascularization. PMID:21919032
  46. Somatostatin and somatostatin analogues reduce PDGF-induced endometrial cell proliferation and motility PMID:22588000
  47. The kidney takes part in the elimination of IL-6 and PDGF from systemic circulation. The kidney does not take part in the elimination of TGF-beta. PMID:22617683
  48. analysis of astrocyte-specific expression patterns associated with the PDGF-induced glioma microenvironment PMID:22393407
  49. Our study was the first to show that CSF PDGF-AA is related to disease duration in relapsing-remitting multiple sclerosis. PMID:21771201
  50. SiO(2) may affect the expression of PDGF and synthesis of collagen through alveolar macrophage mediation and participate in the formation of lung fibrosis. PMID:19493486

Show More

Hide All

Subcellular Location
Secreted. Note=Released by platelets upon wounding.
Protein Families
PDGF/VEGF growth factor family
Database Links

HGNC: 8799

UNIGENE: Hs.535898

KEGG: hsa:5154

STRING: 9606.ENSP00000346508

OMIM: 173430

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products