Recombinant Human Fibroblast growth factor 8 (FGF8), partial (Active)

In Stock Discontinued
Code: CSB-AP004041HU
Size:
10ug
10ug50ug500ug1mg(1mg*1 or 500ug*2)
US$204
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 0.5 ug/ml.
Uniprot NO.
Research Area
Cancer
Alternative Names
AIGF; Androgen induced growth factor; Androgen-induced growth factor; FGF 8; FGF-8; FGF-8b; FGF8; FGF8_HUMAN; Fibroblast growth factor 8 (androgen induced); Fibroblast growth factor 8; Fibroblast growth factor 8 precursor; HBGF 8; HBGF-8; HBGF8; Heparin-binding growth factor 8; HH6; KAL6
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
23-244aa
Target Protein Sequence
QEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.7 kDa
Protein Length
Partial of Isoform 4
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.4
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Plays a role in neurite outgrowth in hippocampal cells.
Gene References into Functions
  1. The expression of BMP4 and FGF8 corelates well with the proliferative component of the pathologies, indicating a possible role in the pathogenesis and progression of Odontogenic Cyst and Tumors. PMID:30079292
  2. Study demonstrated that FGF8 can regulate germ cell fate by modulating the dynamic equilibrium between differentiation and self-renewal. PMID:28898437
  3. FGF8 and FGFR3 may therefore play an important role in the onset of deep zone necrosis and pathogenesis in Kashin-Beck disease in adolescent children. PMID:29626475
  4. we also found that FGF8 increased the expression of YAP1 and knockdown of YAP1 eliminated the upregulation of EGFR and the resistance to EGFR inhibition induced by FGF8. Our study provides evidence that FGF8 plays an important role in the resistance to EGFR inhibition of human hepatocellular carcinoma cells PMID:28791365
  5. Genetic testing identified a de novo, heterozygous mutation in fibroblast growth factor receptor 1 (FGFR1 p.L630P). L630 resides on the ATP binding cleft of the FGFR1 tyrosine kinase domain, and L630P is predicted to cause a complete loss of receptor function. Cell-based assays confirmed that L630P abolishes FGF8 signaling activity PMID:28195315
  6. Bonferroni adjusted p-value: 0.04). No statistically significant associations were identified in the other ethnic groups. In conclusion, variant/s in FGF2 and FGF8 may predispose diabetics with CKD to LEA. PMID:27237708
  7. in one holoprosencephaly (HPE) family, a deleterious FGFR1 allele was transmitted from one parent and a loss-of-function allele in FGF8 from the other parent to both affected daughters. This family is one of the clearest examples to date of gene:gene synergistic interactions causing HPE in humans. PMID:26931467
  8. Fgf8 activates Ras-ERK pathway to specify hindbrain. Downstream of ERK, Pea3 specifies isthmus (rhombomere 0, r0), and Irx2 may specify r1, where the cerebellum is formed. PMID:27273073
  9. Regulation of neurogenesis by Fgf8a requires Cdc42 signaling and a novel Cdc42 effector protein PMID:23994638
  10. Our results link FGF8, c-Abl and p300 in a regulatory pathway that controls DeltaNp63alpha protein stability and transcriptional activity. PMID:25911675
  11. Data indicate that overexpression of fibroblast growth factor 8 (FGF8) correlates with lymph node metastasis and poor prognosis in colorectal cancer (CRC). PMID:25473897
  12. FGF8 mutations (p.Gly29_Arg34dup and p.Pro26Leu) contribute to the formation of the VATER/VACTERL association. PMID:25131394
  13. Scube3 may be a critical upstream regulator of fast fiber myogenesis by modulating fgf8 signaling during zebrafish embryogenesis PMID:24849601
  14. Together, these data demonstrate that FGF (FGFR-2 and Fgf8)signaling regulates cell proliferation and cell polarity and that these cell processes contribute to facial morphogenesis. PMID:23906837
  15. The oncoprotein HBXIP enhances angiogenesis and growth of breast cancer through modulating FGF8 and VEGF. PMID:24464787
  16. genetic association study in population in Massachusetts: Data suggest that clinical features in Kallmann syndrome (KS) are associated with genetic causes: dental agenesis/digital bony abnormalities are associated with variations/mutations in FGF8. PMID:23533228
  17. A novel FGF8b-binding peptide with anti-tumor effect on prostate cancer. PMID:23466786
  18. The results suggest that prolonged and enhanced human fibroblast growth factor 8b signaling induces dramatic changes in the epididymis and testis that lead to infertility in a portion of the human fibroblast growth factor 8b transgenic male mice. PMID:22423049
  19. genetic association studies in 103 patients from US and UK: Mutations in FGF8, FGFR1, or PROKR2 contributed to 7.8% of patients with combined pituitary hormone deficiency or septo-optic dysplasia. Data suggest genetic overlap with Kallmann syndrome. PMID:22319038
  20. In vivo stimulation of BT-474 cell growth by progesterone is associated with down-regulation of FGF-8. PMID:22237711
  21. We implicate FGF8 in the etiology of recessive holoprosencephaly and potentially septo-optic dysplasia/Moebius syndrome PMID:21832120
  22. This novel mechanism of viral-mediated FGF8 upregulation may implicate a new role of oncoviruses in human carcinogenesis. PMID:21119603
  23. FGF8, FGF17, and FGF18 are involved in autocrine and paracrine signaling in HCC and enhance the survival of tumor cells under stress conditions, malignant behavior, and neoangiogenesis. PMID:21319186
  24. FGF8b is able to induce fast growth in strongly hypoxic tumour microenvironment whereas VEGF-stimulated growth advantage is associated with improved perfusion and oxygenation of prostate tumour xenografts PMID:21034500
  25. Results suggest that increased FGF-8 in human prostate may also contribute to prostate tumorigenesis by stromal activation. PMID:21076617
  26. We identified the first nonsense mutations in the FGF8 gene in familial isolated hypogonadotropic hypogonadism with variable degrees of GnRH deficiency and olfactory phenotypes, confirming that loss-of-function mutations in FGF8 cause GnRH deficiency. PMID:20463092
  27. widespread expression pattern suggests FGF8 has physiological roles in adult tissue as well as in development PMID:11953856
  28. Promoter of FGF8 reveals a unique regulation by unliganded RARalpha. PMID:12054865
  29. Regulation of FGF8 expression by the androgen receptor in human prostate cancer. PMID:12140757
  30. isoform b isoform expressed in prostate cancer, and is of prognostic value PMID:12778074
  31. Repression of fgf8 might be directly or indirectly involved in this transcriptional control by TGF-beta. PMID:15935652
  32. We also show that the mode of FGF8 receptor-binding specificity is distinct from that of other FGFs and provide the first biochemical evidence for a physiological FGF8b-FGFR1c interaction during mid-hindbrain development. PMID:16384934
  33. novel role for nuclear factor-kappaB in the regulation of fibroblast growth factor 8(FGF8) expression in prostate cancer cells is uncovered PMID:16683270
  34. These results indicate that mutations are rare in FGF8 and FGFR2 in hypospadias, but gene variants may influence the risk. PMID:17264867
  35. FGF8 has a role in regulation of autocrine and paracrine loops in the growth regulation of breast, prostate and ovarian cancer [review] PMID:17512240
  36. Fgf8 is required for the node to impart left-right asymmetry on specific tissues Excess Fgf8 signaling following a loss of RA may stimulate the node to generate asymmetry in presomitic mesoderm, leading to left-right asymmetry in somitogenesis clock PMID:17600781
  37. FGF-8 is expressed at a high frequency in bone metastases of human prostate cancer and expression of FGF-8 in PC-3 prostate cancer cells increases their growth as intratibial tumors. PMID:18386787
  38. Decreased FGF8 signaling causes deficiency of GnRH in humans. PMID:18596921
  39. associated gene expression signature suggests potential mediators for FGF-8b actions on prostate cancer progression and metastasis PMID:19415685

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Heparin-binding growth factors family
Database Links

HGNC: 3686

UNIGENE: Hs.57710

KEGG: hsa:2253

STRING: 9606.ENSP00000321797

OMIM: 600483

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products