FGF23 is a key phosphaturic hormone implicated in mineral metabolism and tumor-induced osteomalacia, making it a critical target in both cancer biology and metabolic disease research. This tag-free recombinant human FGF23 encompasses the full mature sequence (25–251 aa) and demonstrates robust receptor-binding potency, with an ED50 below 0.5 μg/ml in a Klotho-dependent BaF3 cell proliferation assay, corresponding to a specific activity exceeding 2.0 × 10³ IU/mg — data that supports use in cell proliferation assays, receptor-ligand binding studies via SPR or ELISA, and in vivo tumor biology models. Produced in *E. coli*, the protein lacks mammalian glycosylation, which is advantageous for researchers investigating how post-translational modifications influence FGF23 cleavage and signaling, or for those requiring a defined, unmodified standard for antibody characterization. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based functional assays and sensitive downstream applications.
Do you offer aseptic processing and endotoxin removal for CSB-AP002481HU? Also, how will you supply this protein (liquid or powder)?
YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Email: support@cusabio.com
Distributors Worldwide