Home
Product
Protein
Active Protein
FC Receptor
Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial (Active)

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial (Active)

In Stock

Code: CSB-AP005111HU

Rate （N/A）
Review （0）

Size:

10ug50ug500ug1mg

US$154

Quantity:

Express system: Mammalian cell

Species: Homo sapiens (Human)

Tag Info: C-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Human FCGR3A protein, partial (Active)

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

Loaded Human IgG1 Fc on Protein-A Biosensor, can bind Human CD16a-His (V176) with an affinity constant of 0.571 uM as determined in BLI assay.

Target Names

FCGR3A

Uniprot NO.

AAH17865.1

Research Area

Immunology

Alternative Names

FCGR3A; CD16A; FCG3; FCGR3; IGFR3; Low affinity immunoglobulin gamma Fc region receptor III-A; CD16a antigen; Fc-gamma RIII-alpha; Fc-gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa; FcR-10; IgG Fc receptor III-2; CD antigen CD16a

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

17-208aa

Target Protein Sequence

GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

22.61 kDa

Protein Length

Extracellular Domain

Tag Info

C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from a 0.2 μm filtered 20mM PB, 150mM NaCl, pH 7.4.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

CD16a (FCGR3A) mediates antibody-dependent cellular cytotoxicity by engaging the Fc region of IgG1, making it a critical target for therapeutic antibody optimization and Fc-engineering campaigns. This recombinant human FCGR3A extracellular domain (aa 17–208) carries the V176 polymorphism—the high-affinity variant—and demonstrates confirmed binding to human IgG1 Fc with a KD of 0.571 μM by BLI, providing a suitable basis for affinity characterization, competitive inhibition assays, and blocking antibody screening. Mammalian cell expression preserves native glycosylation patterns essential for proper folding and physiologically relevant receptor-ligand interactions, supporting use in therapeutic antibody epitope mapping, Fc-variant ranking by SPR or BLI, and biologic inhibitor screening. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based ADCC reporter assays and sensitive binding studies where contaminant interference must be minimized.