Abbreviation
Recombinant Mouse Csf2 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using PDC-P1 cells is 40-170 pg/ml.
Alternative Names
Csf2; Csfgm; Granulocyte-macrophage colony-stimulating factor; GM-CSF; Colony-stimulating factor; CSF
Species
Mus musculus (Mouse)
Expression Region
18-141aa
Target Protein Sequence
APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
GM-CSF drives the differentiation and activation of dendritic cells, macrophages, and granulocytes, making it indispensable for studying myeloid biology and inflammatory signaling. This recombinant mouse Csf2 covers the full mature sequence (aa 18–141), expressed in mammalian cells with a C-terminal 6xHis tag, and demonstrates potent bioactivity with an ED50 of 40–170 pg/mL in a TF-1-lineage (PDC-P1) proliferation assay—confirming reliable performance in cell-based functional studies such as myeloid differentiation, JAK/STAT pathway activation, and bone marrow-derived dendritic cell generation. Endotoxin levels below 1.0 EU/μg minimize LPS-driven artifacts, supporting use in sensitive immune cell assays and in vivo murine models of inflammation or tumor biology. Purity exceeding 95% by SDS-PAGE, combined with this stringent endotoxin control, provides a suitable basis for antibody validation workflows, ELISA standard curves, and cytokine detection reference applications.