Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2) (Active)

In Stock
Code: CSB-AP003651MO
Size:
10ug
10ug50ug500ug1mg
US$290
Quantity:
Express system: Mammalian cell
Species: Mus musculus (Mouse)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Mouse Csf2 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using PDC-P1 cells is 40-170 pg/ml.
Target Names
Csf2
Uniprot NO.
Research Area
Immunology
Alternative Names
Csf2; Csfgm; Granulocyte-macrophage colony-stimulating factor; GM-CSF; Colony-stimulating factor; CSF
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
18-141aa
Target Protein Sequence
APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

GM-CSF drives the differentiation and activation of dendritic cells, macrophages, and granulocytes, making it indispensable for studying myeloid biology and inflammatory signaling. This recombinant mouse Csf2 covers the full mature sequence (aa 18–141), expressed in mammalian cells with a C-terminal 6xHis tag, and demonstrates potent bioactivity with an ED50 of 40–170 pg/mL in a TF-1-lineage (PDC-P1) proliferation assay—confirming reliable performance in cell-based functional studies such as myeloid differentiation, JAK/STAT pathway activation, and bone marrow-derived dendritic cell generation. Endotoxin levels below 1.0 EU/μg minimize LPS-driven artifacts, supporting use in sensitive immune cell assays and in vivo murine models of inflammation or tumor biology. Purity exceeding 95% by SDS-PAGE, combined with this stringent endotoxin control, provides a suitable basis for antibody validation workflows, ELISA standard curves, and cytokine detection reference applications.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
Gene References into Functions
  1. Data show that the microbiota enhances respiratory defenses via granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling, which stimulates pathogen killing and clearance by alveolar macrophages PMID:29142211
  2. The data indicate that GM-CSF drives chronic tissue damage and disability in experimental autoimmune encephalomyelitis via pleiotropic pathways, but it is dispensable during early lesion formation and the onset of neurologic deficits. PMID:29288202
  3. the release of IL-33 and GM-CSF from epithelial cells induces the activation of p65 and the p38-MK2/3 signaling module in Dendritic Cells, resulting in Th2 polarization and, finally, allergic inflammation. PMID:29288203
  4. results show T cell production of GM-CSF contributes to control of M. tuberculosis infection in the absence of other sources of GM-CSF, that multiple T cell subsets make GM-CSF in the lung over the course of infection and that GM-CSF can act directly on infected macrophages through a pathway requiring PPARgamma to limit bacterial growth PMID:29066547
  5. In conclusion, our study confirms the pathogenic role of GM-CSF in colitis-associated colorectal cancer development. GM-CSF favors tumor-permissive microenvironment by inducing MDSC generation and recruiting them into colonic tissues. PMID:28534709
  6. these data demonstrate that GM-CSF levels during radiotherapy can be used as a prognostic biomarker for lung and esophageal cancer PMID:27835886
  7. this study demonstrates that epithelial-derived GM-CSF is a critical early signal during allergic sensitization to cockroach allergen PMID:27731325
  8. These impaired macrophage functions in leukemic mice were significantly corrected by IL-3 and GM-CSF treatment indicating the therapeutic benefit of these two cytokines in leukemia. PMID:28039843
  9. Both IL-6 protein production and transcript levels were downregulated by RA in respiratory tract epithelial cells (LETs) , but upregulated in macrophages (MACs). RA also increased transcript levels of MCP-1, GMCSF, and IL-10 in MACs, but not in LETs. Conversely, when LETs, but not MACs, were exposed to RA PMID:27940088
  10. T-GM-CSF and -IL-3 significantly, and reciprocally, blunted receptor binding and myeloid progenitor cell proliferation activity of both FL-GM-CSF and -IL-3 in vitro and in vivo PMID:28344320
  11. Results indicate GM-CSF as both a key contributor to the pathogenesis of MI and a potential therapeutic target. PMID:28978634
  12. Obesity alters the lung neutrophil infiltration to enhance breast cancer metastasis through IL5 and GM-CSF. PMID:28737771
  13. GM-CSF is required for the normal balance of leukocyte subsets, including granulocytes, B cells, and naive vs. effector T cells. There was an approximately 3-fold increase in the percentages of granulocytes in Csf2-/- PBMCs. The presence of maximal experimental autoimmune encephalomyelitis in the complete absence of GM-CSF revealed that GM-CSF is not an obligate effector molecule in all forms of EAE. PMID:27256565
  14. chemerin inhibited nuclear factor-kappaB activation and the expression of granulocyte-macrophage colony-stimulating factor (GM-CSF) and interleukin-2 (IL-6) by tumor cells and tumor-associated endothelial cell, respectively, via its receptors, and consequently, MDSC induction was impaired, leading to restoration of antitumor T-cell response and decreased tumor angiogenesis. PMID:28166197
  15. These findings describe a novel role for GM-CSF as an essential initiating cytokine in cardiac inflammation. PMID:27595596
  16. Data reviewed establish that any damage to brain tissue tends to cause an increase in G-CSF and/or GM-CSF (G(M)-CSF) synthesized by the brain. Glioblastoma cells themselves also synthesize G(M)-CSF. G(M)-CSF synthesized by brain due to damage by a growing tumor and by the tumor itself stimulates bone marrow to shift hematopoiesis toward granulocytic lineages away from lymphocytic lineages. PMID:28459367
  17. Evi1(+)DA-3 cells modified to express an intracellular form of GM-CSF, acquired growth factor independence and transplantability and caused an overt leukemia in syngeneic hosts, without increasing serum GM-CSF levels. PMID:25907616
  18. IL-23-induced GM-CSF mediates the pathogenicity of CD4(+) T cells in experimental autoimmune myocarditis. PMID:26660726
  19. GM-CSF accelerated the G1/S phase transition in EPCs by upregulating the expression of cyclins D1 and E. PMID:24662605
  20. host RNF13 affects the concentration of GM-CSF in tumor-bearing lungs PMID:26197965
  21. Sc CW-derived BG stimulated the late and strong expression of Csf2 in a dectin-1-dependent manner, they remain poor inducers of chemokine and cytokine production in murine macrophages. PMID:26840954
  22. GM-CSF and uPA are required for Porphyromonas gingivalis-induced alveolar bone loss in a mouse periodontitis model. PMID:25753270
  23. These findings identify GM-CSF as central to the protective immune response that prevents progressive fungal disease PMID:26755822
  24. regulatory molecule causative of aortic dissection and intramural haematoma PMID:25923510
  25. Results indicate that granulocyte-macrophage colony-stimulating factor (GM-CSF) signaling controls a pathogenic expression signature in CC chemokine receptors 2 (CCR2+)Ly6C(hi) monocytes. PMID:26341401
  26. TL1A increases expression of CD25, LFA-1, CD134 and CD154, and induces IL-22 and GM-CSF production from effector CD4 T-cells PMID:25148371
  27. Mafb-deficient microglia cultured with GM-CSF barely extended their membrane protrusions, probably due to abnormal activation of RhoA, a key regulator of cytoskeletal remodeling. MafB is a negative regulator of GM-CSF signaling in microglia. PMID:25998393
  28. Csf2-/- mice showed a 30% increase in whole body adiposity, which persisted to adulthood. Adipocytes from Csf2-/- mice were 50% larger by volume and contained higher levels of adipogenesis gene transcripts, indicating enhanced adipocyte differentiation. PMID:25931125
  29. Renal ischemia reperfusion injury tubular cells expressed elevated GM-0CSF, that supports tubular cells proliferation. PMID:25388222
  30. GM-CSF is key to the development of experimental osteoarthritis and its associated pain. PMID:22995428
  31. Loss of encephalitogenic activity of STAT5-deficient autoreactive CD4+ T cells was independent of IFN-gamma or IL-17 production, but was due to the impaired expression of GM-CSF, a crucial mediator of T-cell pathogenicity. PMID:25412660
  32. These data indicate that GM-CSF plays a role in the inflammatory signaling network that drives neutrophil recruitment in response to Clostridium difficile infection but does not appear to play a role in clearance of the infection. PMID:25045999
  33. IRF8 represses GM-CSF expression in T cells to affect myeloid cell lineage differentiation. PMID:25646302
  34. Reprogramming of monocytes by GM-CSF contributes to regulatory immune functions during intestinal inflammation. PMID:25653427
  35. GM-CSF promotes advanced plaque progression by increasing macrophage apoptosis susceptibility. PMID:25348165
  36. although iTreg cells maintained the ability to produce IFN-gamma and TNF-alpha in vivo, their ability to produce GM-CSF was selectively degraded upon antigen stimulation under inflammatory conditions. PMID:25168419
  37. IFN-gamma has a pprotective role in the demyelination of brain through downregulation of IL-17/GM-CSF and induction of neuroprotective factors in the brain by monocytes/microglial cells. PMID:25339670
  38. Expression of PPAR-gamma in fetal lung monocytes was dependent on the cytokine GM-CSF. Therefore, GM-CSF has a lung-specific role in the perinatal development of alveolar macrophages through the induction of PPAR-gamma in fetal monocytes. PMID:25263125
  39. These novel findings indicate that the inflammatory mediator, GM-CSF, may have significant protective properties in the chronic sequelae of experimental Traumatic brain injury PMID:24392832
  40. Airway infections and pollutants increase the susceptibility to develop allergic asthma through a GM-CSF/IL-33/OX40L pathway. PMID:24551140
  41. Data indicate that neutralization of GM-CSF would be a useful therapeutic strategy for severe connective tissue diseases (CTD)-interstitial lung disease (ILD). PMID:24951817
  42. Data indicate that lung epithelium-derived GM-CSF is a critical regulator of CD11b+ dendritic cells (DCs)-mediated Th2 cell priming. PMID:24943219
  43. Bhlhe40 is required positively regulates the production of GM-CSF and negatively regulates the production of IL-10 in T cells. PMID:24699451
  44. Report IL-18 plus GM-CSF modified tumor cell vaccine can induce significant antitumor effects in Lewis lung carcinoma. PMID:24475975
  45. Data indicate that in type 1 diabetes monocytes STAT5Ptyr activation is significantly higher and is found bound to CSF2 promoter and PTGS2 enhancer regions. PMID:24204704
  46. Data indicate that GM-CSF controls IgM production in innate response activator B cells. PMID:24821911
  47. our findings suggest that over-production of GM-CSF by T cells could be a pathogenic factor in many histiocytic disorders PMID:24183847
  48. that p52 binds to the promoter of the GM-CSF-encoding gene (Csf2) and cooperates with c-Rel in the transactivation of this target gene. PMID:24899500
  49. GM-SCF, IL-21 and Rae1 expression, alone or in combination, induces a cellular immune response against H22 tumor cells. PMID:24350772
  50. Data indicate that GM-CSF knockout mice exhibit a unique mix of M1-M2 macrophage phenotypes inalveolar macrophages. PMID:24044676

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
GM-CSF family
Database Links

UNIGENE: Mm.4922

KEGG: mmu:12981

STRING: 10090.ENSMUSP00000019060

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products