Abbreviation
Recombinant Human CSF2RA protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to inhibit GM-CSF-dependent proliferation of TF‑1 human erythroleukemic cells is 0.5-2 μg/ml.
Alternative Names
CD_antigen=CD116; CD116; CD116 antigen; CDw116; Colony stimulating factor 2 receptor alpha chain; Colony stimulating factor 2 receptor alpha low affinity; Colony stimulating factor 2 receptor alpha subunit; CSF 2R; CSF2R; CSF2R_HUMAN; CSF2RA; CSF2RAX; CSF2RAY; CSF2RX; CSF2RY; GM CSF R alpha; GM CSF receptor alpha subunit; GM-CSF-R-alpha; GMCSFR; GMCSFR-alpha; GMR-alpha; Granulocyte macrophage colony stimulating factor receptor alpha chain; Granulocyte-macrophage colony-stimulating factor receptor subunit alpha; SMDP4
Species
Homo sapiens (Human)
Expression Region
23-320aa
Target Protein Sequence
EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
The extracellular ligand-binding domain of human CSF2RA (residues 23–320) provides the critical GM-CSF interaction interface needed for receptor-ligand studies, and this construct demonstrates functional activity with an ED50 of 0.5–2 μg/ml in inhibiting GM-CSF-dependent proliferation of TF-1 cells. Mammalian cell expression preserves native glycosylation and disulfide-mediated folding, supporting conformational integrity essential for accurate affinity characterization by SPR or BLI and for competitive inhibition assays screening blocking antibodies or biologic inhibitors. The C-terminal 6×His tag enables oriented capture on sensor chips or ELISA plates, making this protein appropriate for therapeutic antibody epitope mapping, ligand-binding interaction studies, and use as a positive control in GM-CSF pathway binding assays. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based functional assays and drug discovery screening campaigns.