Recombinant Human C-X-C motif chemokine 14 (CXCL14) (Active)

In Stock Discontinued
Code: CSB-AP003521HU
Size:
10μg
10μg50μg500μg1mg(1mg*1 or 500ug*2)
US$153
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: Tag-Free
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to induce calcium flux of prostaglandin E2 treated THP1 human acute monocytic leukemia cells is typically 1-10 ng/mL.
Target Names
CXCL14
Uniprot NO.
Research Area
Immunology
Alternative Names
1110031L23Rik; 1200006I23Rik; AI414372; BMAC; bolekine; BRAK; Breast and kidney; C-X-C motif chemokine 14; C-X-C motif chemokine ligand 14; Chaemokine; CXC motif; ligand 14; Chemokine (C-X-C motif) ligand 14; Chemokine BRAK; CXC chemokine in breast and kidney ; CXCL14; CXL14_HUMAN; JSC; Kec; Kidney-expressed chemokine CXC; KS1; MGC10687; MGC124510; MGC90667; MIP 2 gamma; MIP-2G; MIP2G; MIP2gamma; NJAC; PRO273; PSEC0212; Scyb14; Small Inducible Cytokine B14; Small inducible cytokine subfamily B (Cys-X-Cys) member 14 (BRAK); Small Inducible Cytokine subfamily B; member 14; Small-inducible cytokine B14; Tumor suppressing chemokine; UNQ240
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
35-111aa
Target Protein Sequence
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
9.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 1 M NaCl, pH 8.5
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Introducing our Recombinant Human CXCL14 protein, a crucial tool for researchers in the field of immunology. This C-X-C motif chemokine 14, known as CXCL14, MIP2G, NJAC, and SCYB14, is expressed in E. coli and covers the 35-111aa expression region of the full-length mature protein. The tag-free protein is provided as a lyophilized powder for straightforward reconstitution with sterile water or buffer, ensuring a variety of experimental applications.

Quality and performance are our top priorities, and our Recombinant Human CXCL14 protein displays a purity of >95% as determined by SDS-PAGE and HPLC analysis. Additionally, endotoxin levels are controlled below 1.0 EU/µg, as determined by the LAL method. The protein exhibits biological activity as assessed by its ability to induce calcium flux of prostaglandin E2 treated THP1 human acute monocytic leukemia cells, with an ED50 typically in the range of 1-10 ng/mL.

CXCL14 has been widely investigated for its roles in immune regulation, tumor progression, and cancer[1]. Studies have revealed its chemotactic functions on monocytes and dendritic cells[2] and its tumor-suppressive properties in several cancer types[3]. This highlights the significance of CXCL14 in immune system research and its potential as a therapeutic target for immune-related diseases and cancer.

References:
1. Hara T, et al. Identification of a chemotactic ligand for CXCR1 and CXCR2 in human osteosarcoma cells. Biochem Biophys Res Commun. 2009;386(4): 694-9.
2. Hromas R, et al. Cloning of BRAK, a novel divergent CXC chemokine preferentially expressed in normal versus malignant cells. Biochem Biophys Res Commun. 1999;255(3): 703-6.
3. Tanegashima K, et al. The Chemokine CXCL14 suppresses the tumorigenicity of hepatocellular carcinoma cells. Int J Cancer. 2013;132(4): 949-60.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.
Gene References into Functions
  1. These findings indicate that CXCL14 is a critical immunomodulator involved in the stroke-induced inflammatory reaction. PMID:28382159
  2. High CXCL14 expression is associated with metastatic progression of Ovarian Cancer. PMID:28087599
  3. These results suggest that CXCL14 downregulation by human papillomaviruses plays an important role in suppression of antitumor immune responses. PMID:27143385
  4. Platelets are a relevant source of CXCL14. Platelet-derived CXCL14 at the site of vascular lesions might play an important role in vascular repair/regeneration. PMID:28359053
  5. Epithelial CXCL14 expression is significantly associated with ERalpha positivity and low proliferation, whereas stromal CXCL14 expression is not linked to any of the established clinicopathological parameters, subtypes of breast cancer or tumour stroma abundance. PMID:27115465
  6. Elevated expression of CXCL14 in osteosarcoma tissues correlated with poor prognosis of the osteosarcoma patients. PMID:27259322
  7. Elevated S100A6 enhances tumorigenesis and suppresses CXCL14-induced apoptosis in clear cell renal cell carcinoma. PMID:25760073
  8. three of these five genes (CXCL14, ITGAX, and LPCAT2) harbored polymorphisms associated with aggressive disease development in a human GWAS cohort consisting of 1,172 prostate cancer patients. PMID:25411967
  9. Prometastatic effects of IRX1 were mediated by upregulation of CXCL14/NF-kappaB signaling. PMID:25822025
  10. CXCL14 overexpression influences proliferation and changes in cell cycle distributions of HT29 colorectal carcinoma cells. PMID:24938992
  11. Data indicate that site-specific CpG methylation in the CXC chemokine CXCL14 promoter is associated with altered expression. PMID:25102097
  12. CXCL14 displays antimicrobial activity against E. coli and S. aureus. PMID:12949249
  13. Genetic or pharmacologic inhibition of NOS1 reduced the growth of CXCL14-expressing fibroblasts. PMID:24710408
  14. CXCL14 inhibits colorectal cancer migration, invasion, and epithelial-to-mesenchymal transition (EMT) by suppressing NF-kappaB signaling. PMID:24099668
  15. Downregulation of CXCL14 expression is associated with gastric adenocarcinoma. PMID:23982764
  16. CXCL14 plays a pivotal role as a potential tumor suppressor in hepatocellular carcinoma. PMID:24033560
  17. Smoking-induced CXCL14 expression in the human airway epithelium links chronic obstructive pulmonary disease to lung cancer. PMID:23597004
  18. CXCL14 binding to glycoproteins harboring heparan sulfate proteoglycans and sialic acids leads proliferation and migration of some cancer cells. PMID:23161284
  19. CXCL14 might be a potential novel prognostic factor to predict the disease recurrence and overall survival and could be a potential target of postoperative adjuvant therapy in CRC patients PMID:23294544
  20. CXCL14 is a negative regulator of growth and metastasis in breast cancer. PMID:22910931
  21. These results indicated that upregulation of BRAK was accompanied by differentiation of epithelial cells induced by calcium/calmodulin signaling, and that SP1 binding to the BRAK promoter region played an important role in this signaling. PMID:22382027
  22. The rs2237062 polymorphism in the CXCL14 gene might influence Hepatits B Virus-related hepatocellular carcinoma progression in a Chinese population. PMID:21556757
  23. CEACAM-1 and CXCL-14 are involved in the occurrence and development of infantile hemangioma. PMID:20737948
  24. The results indicate that oxidative stress induced by H(2)O(2) or HO(*) stimulates angiogenesis and tumuor progression by altering the gene expression of CXCL14 via the EGFR/MEK/ERK pathway in human HNSCC cells. PMID:20815772
  25. Data indicate that the expression of BRAK stimulated the formation of elongated focal adhesions of the HSC-3 cells in an autocrine or paracrine fashion, in which stimulation may be responsible for the reduced migration of the cells. PMID:20067447
  26. CXCL14 methylation in sputum from asymptomatic early-stage lung cancer cases was associated with a 2.9-fold elevated risk for this disease compared with controls, substantiating its potential as a biomarker for early detection of lung cancer PMID:20562917
  27. Taken together, the data indicate that the respective stress-dependent action of p38 isoforms is responsible for the up-regulation of the gene expression of the chemokine BRAK/CXCL14. PMID:20478268
  28. CXCL14 removal from conditioned media abolished its chemotactic properties. Findings offer direct evidence for epigenetic regulation of chemokine expression in tumor cells. PMID:20460540
  29. Increased severity of collagen-induced arthritis in CXCL14-transgenic mice is associated with enhanced T helper (Th) type 1 cytokine production, elevated autoantibody levels and increased inflammatory cell infiltration into the joints. PMID:20212097
  30. Data conclude that CXCL14 is likely to be regulated by progesterone in human endometrium and that it may exert a chemoattractive effect on uNK cells and in part be responsible for their clustering around the epithelial glands. PMID:19903701
  31. Results suggest that CXCL14 plays an important role in regulating trophoblast invasion through an autocrine/paracrine manner during early pregnancy. PMID:19833716
  32. loss of BRAK expression from tumors may facilitate neovascularization and possibly contributes to immunologic escape PMID:15548693
  33. The finding that CXCL14 expression inhibits prostate tumor growth suggests this gene has tumor suppressive functions. PMID:15651028
  34. CXCL14 is a potent chemoattractant and activator of dendritic cells (DC) and may be involved in DC homing in vivo. PMID:15843547
  35. results indicate that BRAK/CXCL14 is a chemokine, having suppressive activity toward tumor progression of oral carcinoma in vivo PMID:16884687
  36. This study elucidates a post-translational mechanism for the loss of CXCL14 in cancer and a novel mode of chemokine regulation. PMID:16987528
  37. CXCL14 might play a pivotal role in the pathobiology of pancreatic cancer, probably by regulating cancer invasion. PMID:18054154
  38. CXCL14 is a gene target of RhoBTB2 and supports downregulation of CXCL14 as a functional outcome of RhoBTB2 loss in cancer. PMID:18762809
  39. CXCL14-positive epithelial cells were found in all tissue types. The expression of CXCL14 was not associated with any tumor or patient characteristics analyzed PMID:18765527
  40. Data suggest that despite the structural homology and similarity in tissue distribution of human and murine CXCL14, distinct differences point to diverse, species-specific needs for CXCL14 in epithelial immunity. PMID:18809336
  41. Cell supernatant-derived CXCL14 fights bacteria at the earliest stage of infection, well before the establishment of inflammation, and thus fulfills a unique role in antimicrobial immunity. PMID:19109182
  42. regulates energy metabolism and eating behaviior, induces insulin resistance, suppresses induction of neovascularization. (review) PMID:19172796
  43. identify CXCL14 as a novel autocrine stimulator of fibroblast growth and migration, with multi-modal tumor-stimulatory activities PMID:19218429
  44. CXCL14 expression is upregulated by ROS through the AP-1 signaling pathway and promotes cell motility through elevation of cytosolic Ca(2+) by binding to the inositol 1,4,5-trisphosphate receptor on the endoplasmic reticulum in breast cancer. PMID:19276362
  45. -A-induced migration depends on the selective and polarized release of 2 chemokines, namely CXC chemokine ligands 12 and 14 PMID:19339694

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine alpha (chemokine CxC) family
Tissue Specificity
Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derived dendritic cells. N
Database Links

HGNC: 10640

UNIGENE: Hs.483444

KEGG: hsa:9547

STRING: 9606.ENSP00000337065

OMIM: 604186

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products