Home
Product
Protein
Active Protein
Chemokine
Recombinant Human C-X-C motif chemokine 10 (CXCL10) (Active)

Recombinant Human C-X-C motif chemokine 10 (CXCL10) (Active)

In Stock Discontinued

Code: CSB-AP003501HU

Rate （N/A）
Review （0）

Size:

10ug50ug500ug1mg(1mg*1 or 500ug*2)

US$154

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: Tag-Free

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

The ED50 as determined by its ability to chemoattract human CXCR3 transfected BaF3 mouse proB cells is typically 0.02-0.06 μg/mL.

Uniprot NO.

P02778

Research Area

Immunology

Alternative Names

Interferon gamma induced factor MOB1; mouse; homolog of; Interferon gamma induced protein 10; 10 kDa interferon gamma induced protein; 10 kDa interferon gamma-induced protein; C X C motif chemokine 10; C7; Chemokine (C X C motif) ligand 10; Chemokine CXC motif ligand 10; Crg 2; CRG2; CXCL10; CXCL10(1-73); CXL10_HUMAN; Gamma IP10; Gamma-IP10; gIP 10; GIP10; IFI10; INP 10; INP10; Interferon activated gene 10; Interferon activated gene 10; Interferon gamma induced cell line; Interferon inducible cytokine IP 10; Interferon inducible cytokine IP10; IP 10; IP-10; Mob 1; MOB1; Protein 10 from interferon (gamma) induced cell line; SCYB10; Small inducible cytokine B10; Small inducible cytokine B10 precursor; Small inducible cytokine subfamily B (Cys X Cys) member 10; Small inducible cytokine subfamily B CXC member 10; Small inducible cytokine subfamily B; member 10; Small-inducible cytokine B10

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

22-98aa

Target Protein Sequence

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

8.6 kDa

Protein Length

Full Length of Mature Protein

Tag Info

Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from a 0.2 μm filtered PBS, pH 7.4.

Lead Time

Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects. Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites. Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization. In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation. Activation of the CXCL10/CXCR3 axis plays also an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization.

Gene References into Functions

results of study suggest that the CXCL10 overexpression in the salivary glands is caused mainly by IFN-gamma-stimulated salivary gland ductal cells. PMID:29549479
Urinary CXCL10 reflects subclinical inflammation within the tubulointerstitial and peritubular capillary spaces, but not the vascular/systemic compartments PMID:28902772
CXCL10 in the serum of patients with vitiligo and alopecia areata was significantly elevated compared with healthy controls, but was similar between patients with vitiligo and AA PMID:27863059
IP-10 might be involved in the pathogenesis of thrombocytopenia (T), anasarca (A), fever (F), reticulin fibrosis (R), and organomegaly (O) -idiopathic Multicentric Castleman disease. PMID:28205564
CXCL10, not CXCL9 or CXCL11, induced IL-9 expression in the liver tissue. PMID:29860220
serum IP-10 level and the IFN-gamma/IL-4 ratio have great potential to predict significant fibrosis among chronic hepatitis B patients. PMID:28067328
No association between IP-10 serum-levels and cancer-related fatigue. PMID:30188739
CXCL10 rs1439490 G/G is positively associated with seronegative occult hepatitis C virus infection and antiviral treatment outcome. PMID:29853737
Age-related epigenetic and genetic factors which contribute to the dysregulation of CXCL10. PMID:29223680
COMMD7 activates CXCL10 production by regulating NFkappaB and the production of ROS. The present study highlighted the role of COMMD7 in the development of HCC, and provides novel options for anticancer drug design. PMID:29532873
Nab-PTX treatment could increase CXCL10 expression. PMID:29902349
The frequency of non-classical monocytes spontaneously producing CXCL10 was increased in both limited and diffuse systemic sclerosis PMID:29127442
serum levels in active vitiligo significantly elevated compared to those in stable vitiligo patients PMID:29115683
Plasma CXCL10 levels are significantly higher in SPs pre-HAART and RPs pre-HAART when compared with HIV-negative controls. PMID:29122683
Hepatitis b vaccine was efficient in enhancing IP-10 level with HBsAg clearance, or reduction to a favorable level. PMID:28802168
Results show that the expression of IP-10 in peripheral blood of patients with HBV-associated acute-on-chronic liver failure (HBV-ACLF) was significantly high and correlated with the severity of liver failure. IP-10 played an important role in the pathogenesis and progression of HBV-ACLF. PMID:29058291
Differential regulation of cytokine release at both transcriptional and post-transcriptional levels, suppresses type-I-IFN induction yet allows for CXCL10 secretion during imDNA-induced cellular stress. PMID:27941826
the elevated concentrations of CXCL13, CXCL8, and CXCL10 or their increasing CSF/serum ratios may be potential biomarkers of neurosyphilis PMID:27650493
Results highlight the role of phytohaemagglutin-stimulated peripheral blood mononuclear cells from patients with Alzheimer's disease on the expression of chemokines CXCL10 and CCL4 by endothelial cells and H4 cell line (mimicking the brain parenchyma) in a human blood brain barrier model. PMID:28413983
viral and bacterial co-infection modulates the JAK-STAT signaling pathway and leads to exacerbated IP-10 expression, which could play a major role in the pathogenesis of pneumonia. PMID:27922126
Study suggests that rs56061981 and rs56216945 in CXCL10 gene promoter contribute COPD susceptibility. PMID:29285564
Our findings showed that the assessment of serum IP-10 level could be a predictive factor for SVR and it was associated with fibrosis, necroinflammatory activity, significant steatosis and IR in patients with chronic HCV infection. PMID:28862188
In conclusion, IL-29 enhanced CXCL10 production in human oral epithelial cells via the p38 MAPK, STAT3, and NF-kappaB pathways, which might control Th1-cell accumulation in periodontal lesions and be involved in pathological processes in periodontal disease. PMID:28753407
Interferon-gamma-inducible protein 10 (IP-10) directly promoted hepatocyte apoptosis, and baseline IP-10 levels may predict the decrease in the hepatitis B surface antigen levels after entecavir therapy in patients with chronic hepatitis B. PMID:28614914
data indicate that IP-10 is associated with disease activity and perseverance of rheumatoid arthritis. PMID:28592626
CXCL10 in addition to IFN-gamma can be used to differentiate among Mycobacterium tuberculosis infection possibilities. PMID:28610785
Increased amniotic fluid CXCL10 concentration is associated with chronic chorioamnionitis or maternal anti-fetal rejection, whereas increased amniotic fluid IL-6 concentration is associated with acute histologic chorioamnionitis. PMID:28544362
Cord blood CXCL10 levels were negatively associated with mite sensitization at age 3. A high cord blood CCL22/CXCL10 chemokine ratio was significantly associated with a higher risk of allergic sensitization at age 3. PMID:27863395
CXCL10/IP-10 transcript showed up to 20 fold-increase, with similar changes detectable at the protein level in melanoma cells overexpressing PDFGRA. PMID:27764787
this study suggests that GG genotype of CXCL10 -135G/A (rs56061981) polymorphism decreased CXCL10 expression in T cells which may have defective recruitment of mononuclear cells at the site of infection as well granuloma formation and in turn contribute to progression of tuberculosis PMID:28336310
The regular early post-transplantation monitoring of urinary miR-155-5p and CXCL10 can help in the prognosis of acute rejection and graft dysfunction after kidney transplantation. PMID:28880456
gene polymorphisms of IL-8(-251T/A) and IP-10(-1596C/T) are associated with susceptibility and progression of type 2 diabetic retinopathy in a northern Chinese population PMID:27935598
Higher serum levels of CXCL10 are found in patients with non-segmental vitiligo (NSV) and NSV + autoimmune thyroiditis than in controls. PMID:28698095
results indicated that CXCL10, a pro-inflammatory chemokine, might be involved in the abnormal immune response in aplastic anaemia. PMID:28411045
IP-10 low in the tumor microenvironment can be used as potential indicators for the progression of non-small cell lung cancer PMID:28375674
The serum IP10 concentrations increase in women with polycystic ovary syndrome (PCOS), moreover, IP10 appears to be correlated with the inflammatory and Insulin resistance statuses of PCOS. IP10 may be a potential biomarker to estimate the disease activity of PCOS. PMID:28051885
EGF and IP-10 were significantly elevated and GRO levels were lower in the tear profile of HIV patients with dry eye disease (DED) compared to immunocompetent patients with DED. PMID:27585367
Determination of serum IP-10 levels before treatment could be useful for predicting favorable virologic response to TVR-based triple therapy, especially in patients with IL28B non-TT genotype. PMID:27541605
In lipotoxic hepatocytes, MLK3 activates a MAPK signaling cascade, resulting in the activating phosphorylation of STAT1, and CXCL10 transcriptional upregulation. PMID:28262979
Neuroendocrine-like cells promote the chemotaxis activity of tumor-associated macrophages (TAM) via CXCL10 and CXCL11. PMID:27034164
These results showed that the higher levels of CXCL10, CCL20 and CCL22 were associated with ischemic heart disease. The serum levels of chemokines may influence by the certain traditional risk factors of IHD and some studied SNPs, but did not influence by treatment and gender of patients. PMID:27152707
High CXCL10 expression is associated with clear-cell renal cell carcinoma. PMID:26910919
a massive and selective serum CXCL10 response in R. conorii-infected patients, likely reflecting release from infected endothelial cells characterized by infiltrating T cells and monocytes. PMID:27180202
The strongest OR was for CXCL8 (interleukin-8) in serum (96.8, 95% CI: 11.9-790.2). Of these 15 markers, 6 were also significantly elevated in serum from Chile (CCL20, C-reactive protein, CXCL8, CXCL10, resistin, serum amyloid A). PMID:27173614
These findings elucidate an NFAT-MAPK signaling paradigm for induction of isletokine expression in beta-cells and reveal IP-10 as a primary therapeutic target to prevent beta-cell-induced inflammatory loss of graft function after islet cell transplantation. PMID:28855240
High urine CXCL10 level is associated with acute rejection in Histologically Stable Kidney transplant Recipients. PMID:26694099
IL-10, IL-17 and IP-10 response to tubercular antigens act as potent discriminative markers for active tuberculosis among pulmonary tuberculosis suspects. PMID:27450011
The performance of IFNG release assays is robust despite variations in the incubation temperature between 37 degrees C and 39 degrees C for the diagnosis of latent tuberculosis infection. PMID:27156612
A novel function of CXCL10 in mediating monocyte production of proinflammatory cytokines in inflammatory bowel diseases has been described. PMID:28899907
CXCL10 is a circulating inflammatory marker elevated in advanced heart failure. PMID:27271043

Hide All

Subcellular Location

Secreted.

Protein Families

Intercrine alpha (chemokine CxC) family

Tissue Specificity

Mainly secreted by monocytes, endothelial cells as well as fibroblasts. Expressed by epithelial cells in thymus. Microglial cells produce CXCL10 in response to viral stimulation.

Database Links

HGNC: 10637

UNIGENE: Hs.632586

KEGG: hsa:3627

STRING: 9606.ENSP00000305651

OMIM: 147310

Promotions