YAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPDKPKNPAYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Endopeptidase that degrades various components of the extracellular matrix such as collagen. Activates progelatinase A. Essential for pericellular collagenolysis and modeling of skeletal and extraskeletal connective tissues during development. May be involved in actin cytoskeleton reorganization by cleaving PTK7. Acts as a positive regulator of cell growth and migration via activation of MMP15. Involved in the formation of the fibrovascular tissues. Cleaves ADGRB1 to release vasculostatin-40 which inhibits angiogenesis.
Gene References into Functions
Overexpression of MMP-14 in familial amyloidotic polyneuropathy might be associated with the inflammatory process and can also contribute to further remodeling of the ECM.PMID:28993312
MT1-MMP expressed by vascular smooth muscle cells plays a key role in limiting the progression of atherosclerosis in APOE-null mice by regulating proliferative responses and inhibiting the deterioration of VSMC function in atherogenic vascular walls.PMID:28735290
MMP-14 levels decrease in lungs from endotoxemic mice and serum from septic patients. * Mmp14 (-/-) mice show increased lung injury and mortality following endotoxemia. * Absence of Mmp14 decreases activated MMP-2 and increases S100A9 levels in lung tissue. * MMP-14 ameliorates inflammation by promoting S100A9 cleavage by activated MMP-2.PMID:28120021
Study documents that MT1-MMP is widely expressed in the tooth and surrounding connective tissues during development and postnatal growth. Consistent with this expression, loss of MT1-MMP in mice impairs tooth root formation and eruption in association with multiple defects in dentoalveolar tissues.PMID:26780723
Authors demonstrate that CAIX associates with MMP14 through potential phosphorylation residues within its intracellular domain, and that CAIX enhances MMP14-mediated collagen degradation by directly contributing hydrogen ions required for MMP14 catalytic activity.PMID:28692057
High mmp14 expression is associated with Lung Metastasis of Breast Cancer.PMID:29033361
Although neither proteinase is required for branching morphogenesis, transcriptome profiling reveals a key role for MMP14 and MMP15 in regulating mammary gland adipocyte differentiation. Whereas MMP14 promotes the generation of white fat depots crucial for energy storage, MMP15 differentially controls the formation of thermogenic brown fat.PMID:27633994
The authors identified the membrane-tethered matrix metalloprotease MT1-MMP as a prominent host-extracellular matrix-remodeling collagenase in influenza infection.PMID:27736644
MMP-14 expression in fibroblasts plays a crucial role in collagen remodeling in adult skin and largely contributes to dermal homeostasis underlying its pathogenic role in fibrotic skin disease in a mouse modelPMID:27066886
MT1-MMP directly cleaves LYVE-1 on lymphatic endothelial cells to inhibit LYVE-1-mediated lymphangiogenic responses and restrains the production of VEGF-C.PMID:26926389
The authors propose a model for cell-regulated collagen fibril assembly during tendon development in which MMP14 cleaves a molecular bridge tethering collagen fibrils to the plasma membrane of fibripositors.PMID:26390284
We demonstrate that MMP-14-mediated signaling in fetal hepatic progenitor cells promotes biliary luminal formation around the portal vein and negatively controls the maturation of hepatocytes.PMID:26724533
Results show a reciprocal association between levels of heparanase and MMP14, a membrane-bound MMP, shedding light on how branching occurs within developing mammary glands.PMID:25735873
MT1-MMP proteolytic activity is required for maintaining cell integrity, loss of MT1-MMP causes cell senescence and nuclear defects.PMID:25991604
Angiotensin II suppresses RECK, but induces matrix metalloproteinases both in vivo and in vitro.PMID:24095877
Active MT1-MMP promotes Notch1 cleavage independently of ADAM10 or -17.PMID:24492617
LV mass was similar among WT, MT1-MMP overexpression, and MT1-MMP reduced expression after PO, significant differences in LV function.PMID:24395927
In the kidneys of Sirt1(endo-/-) mice, impaired angiogenesis, reduced matrilytic activity, and retention of the profibrotic cleavage substrates tissue transglutaminase and endoglin accompanied MMP-14 suppression.PMID:24136919
CD44 and MT1-MMP are directly or indirectly involved in the regulation of pro-MMP9 activation.PMID:23984338
These data point to a role of MMP-14 during transendothelial migration of monocytes and T-cell attraction.PMID:23438475
MT1-MMP controls stem cell commitment by remodeling the 3D extracellular matrix.PMID:23685250
MT1-MMP-catalyzed activation of proMMP-2 is involved in the outgrowth of cultured lymphatic endothelial cells in a collagen matrix in vitro, as well as in lymphatic vessel sprouting assayed ex vivoPMID:23413031
This study elaborates on the interactions between MT1-MMP and FGFR-1, Ras, and ERK in the bFGF-induced VEGF-A expression pathways within the corneal fibroblasts.PMID:22670674
STAT3 phosphorylation was triggered in MSC treated with the MT1-MMP inducer lectin Concanavalin-A (ConA).PMID:22971618
Bioinformatics analysis revealed a combinatorial MT1-MMP proteolytic program, in which combined rather than single substrate processing would determine biological decisions by activated endothelial cells.PMID:22859368
Sustained angiogenesis was observed in MMP-14(ep-/-) mice in contrast to control mice.PMID:22717126
this study clearly demonstrates MT1-MMP requirement in BMSC-mediated angiogenesis.PMID:22262018
The data revealed a regulatory paradigm for FGRF2 signaling and identified MT1-MMP as a critical negative modulator of ADAM9 activity to maintain FGFR2 signaling in calvarial osteogenesis.PMID:22632802
MT1-MMP in niche cells regulates postnatal hematopoiesis, by modulating hematopoietic hypoxia-inducible factor-1 - dependent niche factors that are critical for terminal differentiation and migration.PMID:22544701
This study identifies MT1-MMP as a key matrix metalloproteinase responsible for effecting postinfarction cardiac extracellular matrix remodeling and cardiac dysfunction.PMID:22464947
The functional interplay between cell adhesion molecule L1, ANT proteins, and MMP14, at the plasma membrane mediates L1-induced neurite outgrowth of cerebellar neurons.PMID:22423112
MT1-MMP knockdown increased the osteocyte response to mechanical stimulation, demonstrating a novel and unexpected role for MT1-MMP in mechanosensing.PMID:22202174
These results represent the first attempt to dissect the contribution of the two invasion-promoting activities of MT1-MMP to macrophage invasion.PMID:21893028
Data provide evidence for a concerted HIF-1alpha/MT1-MMP signalling axis that explains the induction of adaptor protein 3BP2 and which may link protein binding partners together and stimulate oncogenic MSC migration.PMID:21738685
We conclude that modulating myocardial MT1-MMP levels affected LV function and matrix structurePMID:21666120
The MAPK signaling pathway is a potential key intracellular modulator of Ang II-induced increase in MMP-2 activity and MMP-14 and BSG protein expression.PMID:21641389
matrix metallopeptidase 14-dependent collagenolysis plays the major role in regulating adipogenic histone marks by releasing the epigenetic constraints imposed by fibrillar type I collagenPMID:21436261
analysis of Warburg effect that arises in tumor cells expressing membrane type-1 matrix metalloproteinasePMID:21372132
Data show that biallelic loss of PTEN is associated with posttranslational regulation of MT1-MMP protein in PC cells.PMID:20620173
important role for MT1-MMP in kidney development, which is mediated by its ability to regulate cell proliferation and migration by proteolytically cleaving kidney basement membrane componentsPMID:20727881
The MMP14 gene directs obesogenic collagen turnover and is linked to human obesity traits.PMID:20660624
Cardiac restricted overexpression of membrane type-1 matrix metalloproteinase causes adverse myocardial remodeling following myocardial infarction.PMID:20643648
These data define a central pathway involving MMP14 and TGFbeta that mediates vessel stability.PMID:20223936
membrane type-1 matrix metalloproteinase has a role in cancer cell motility and tumor growth, and selective MT1-MMP inhibitors may have utility as anticancer agentsPMID:19855192
Podosomes mediate migration of dendritic cells through tissues by means of myosin-II-dependent protrusion coupled to MMP-14-dependent degradation and endocytosis.PMID:20356925
Results suggest a multifunctional role for MT1-MMP in thoracic aortic aneurysm development that is defined through two phases of expression and activity.PMID:20418476
The MT1-MMP regulates macrophages via its invasion-promoting protease activity as well as its cytoplasmic-dependent non-proteolytic activity to boost cell migration.PMID:19371380
Retroviral rescue experiments and protein binding assays delineate a signaling pathway in which MT1-MMP, via its cytosolic tail, contributes to macrophage migration and fusion by regulating Rac1 activity through an association with p130Cas.PMID:20152179
MT1-MMP modulates the extracellular function transglutaminase 2 (TG2) as part of a regulatory mechanism activates the pro-mineralization function of TG2.PMID:20049897
Show
More
Hide
All
Subcellular Location
Membrane; Single-pass type I membrane protein; Extracellular side. Melanosome. Cytoplasm.
Protein Families
Peptidase M10A family
Tissue Specificity
Highly expressed in placenta, kidney, heart, lung, embryonic skeletal and periskeletal tissues.