Recombinant Human Protransforming growth factor alpha (TGFA)

Code: CSB-CF023445HU
Size:
20μg
20μg100μg
US$3520
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
TGFA
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
24-160
Target Protein Sequence
ENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
Gene References into Functions
  1. The abnormally elevated expression of EGF and TGF-alpha are closely associated with the occurrence and development of chronic pancreatitis and pancreatic cancer PMID:29125273
  2. MiR-199a-5p may mediate cleft lip with or without cleft palate by regulating key target gene TGFA. PMID:29958595
  3. this study demonstrated that TP73-AS1 regulated Colorectal cancer (CRC)progression by acting as a competitive endogenous RNA to sponge miR-194 to modulate the expression of TGFa PMID:30010111
  4. There was evidence suggestive of gene-gene joint-effects between MTHFR-TGFA for nsCP but not for nsCL+/-P. PMID:27996298
  5. TGFA TaqI polymorphism was not associated with the risk of nonsyndromic cleft lip and/or palate in Iranian children. PMID:29105380
  6. We identi fi ed a signi fi cant association between the SNP rs2862851 and disease status of knee Osteoarthritis. Allelic analyses showed that the T allele of this SNP signi fi cantly elevated the risks of Osteoarthritis. Haplotype-based analyses have also identi fi ed a strong association signal between one haplotype block, including rs2862851, and the disease status of knee Osteoarthritis. PMID:28777012
  7. Results suggest a long non-coding RNA MALAT1/MIR376A/transforming growth factor alpha (TGFA) axis mediates osteosarcoma (OS) cell proliferation and tumor progression. PMID:27458156
  8. The association of the TGFA gene with NS-CL+/-P in Korean populations was not clearly found. However, the etiologic effect of the TGFA gene on NS-CL+/-P patients should be investigated in terms of maternal genotype influence. PMID:24805869
  9. These results support that two SNPs are associated with nonsyndromic CL/P but not for CP in northern Chinese populations. PMID:23742131
  10. There were no significant differences in GE area of infertile and fertile women. C-C motif chemokine 11 (P=0.048), TGFalpha (P=0.049), IFNgamma (P=0.033) and interleukin-1 alpha (P=0.047) were significantly elevated in uterine lavage from infertile women <35years compared to fertile but not in women 35years PMID:27525354
  11. results therefore demonstrate cancer epigenetics induces a loop of cancer-stroma-cancer interaction in omental microenvironment that promotes peritoneal metastasis of ovarian cancer cells via TNFalpha-TGFalpha-EGFR. PMID:28166193
  12. In conclusion, we identified four novel loci (TGFA, PIK3R1, FGFR3 and TREH) and confirmed two loci known to be associated with cartilage thickness.The identified associations were not caused by rare exonic variants. This is the first report linking TGFA to human Osteoarthritis, which may serve as a new target for future therapies. PMID:27701424
  13. Our study showed that TGFA/TGFB3/MSX1 gene polymorphisms were associated with congenital NSHI. The distribution of genotype frequencies and allele frequencies of TGFA rs3771494, TGFB3 rs3917201 and rs2268626, and MSX1 rs3821949 and rs62636562 were significantly different between the case and the control groups PMID:27356075
  14. TGFA gene expression is regulated by MiR-374a in lung adenocarcinoma.TGFA plays role in lung adenocarcinoma cell proliferation and invasion. PMID:27207663
  15. Overall, our findings indicated that intratumoral administration of TGFalphaL3-SEB effectively inhibited the growth of breast tumors through induction of necrosis and suppressing proliferation and angiogenesis without systemic toxicity. PMID:26561468
  16. TGFA expression decreased after 10 and 30min of treatment even when transcription was not inhibited. We found that activation of PI3K was necessary for triiodothyronine to modulate HIF1A and TGFA expression PMID:27094789
  17. This is the first demonstration that miR-490-3P might act as a suppressor in endometrial cancer tumorigenesis and progression by targeting TGFalpha. PMID:26843615
  18. miR-505 acts as tumor suppressor in endometrial cancer by regulating TGF-alpha. PMID:26832151
  19. findings strongly suggest that phosphorylated HSP20 inhibits TGF-alpha-induced HCC cell migration and invasion via suppression of the JNK signaling pathway PMID:27046040
  20. miR-205 may function as a tumor suppressor via targeting TGF-alpha in Osteosarcoma PMID:26708425
  21. EGFR and TGF-alpha can be used as predictive markers for activity, fibrosis, and carcinogenesis in chronic hepatitis C patients. PMID:26279457
  22. Data suggest that placental expression of TGFA, EGF (epidermal GF), and HBEGF (heparin-binding EGF-like GF) is down-regulated in pre-eclampsia as compared to normal term birth; each GF blocks cell death/apoptosis of cytotrophoblast cell line. PMID:25589361
  23. TGF-alpha level correlated with efficacy, and EGFR overexpression might predict cetuximab efficacy. PMID:25234930
  24. The data suggest that the balance of TGFA and TGFbeta(1) expression, and to a lesser extend TGFA alone, in the normal-appearing rectal mucosa may be directly associated with risk for incident, sporadic colorectal neoplasms. PMID:24719252
  25. Statistically significant differences in serum concentration of TGF-alpha was found between patients with systemic sclerosis and controls, as well as in SSc patients with esophageal dysmotility compared to SSc patients without dysmotility. PMID:25083591
  26. Findings suggest that miR-124 inhibits TGF-alpha-induced epithelial-mesenchymal transition in human prostate cancer cell line DU145 by targeting Slug. PMID:24969691
  27. TGFA Taq I polymorphism may be associated with the risk of cleft lip and/or palate. PMID:25015300
  28. SPC18 contributes to malignant progression through promotion of TGF-alpha secretion in gastric cancer. PMID:23995782
  29. Functional TGF-alpha gene variant may contribute to the risk of intestinal gastric cancer and/or gastric noncardia cancer. PMID:24237184
  30. The biomarker signature consisting of TNFR-II, TGF-alpha, TIMP-1 and CRP is significantly prognostic of survival in patients with high-risk melanoma. PMID:24457057
  31. These results suggest that overexpression of TGF-a through induction of EGFR-MET interaction contributes to cetuximab resistance in colorectal cancer cells. PMID:24122793
  32. Data suggest that up-regulation of TGFA/EGFR (epidermal growth factor receptor) signal transduction activates transcription factor NFkappaB resulting in up-regulation of expression of ICAM1 (intercellular adhesion molecule 1) in osteosarcoma cells. PMID:24685520
  33. COX-2 is insufficient for modifying the hepatocarcinogenesis course mediated by c-myc/TGF-alpha PMID:23579063
  34. Found progressive loss of PTEN and increase in EGFR, TGF-alpha, P-AKT expression from benign samples to non small cell lung cancer. Changes were correlated to differentiation extent of cancer tissue, metastasis of lymph nodes and histological classification. PMID:24133589
  35. findings suggest that elevated PHD4 levels disturb the angiogenic balance in osteosarcoma via induction of the TGF-alpha pathway and inhibit tumor growth by reducing the expression of HIF-2alpha PMID:24048703
  36. involvement of PAX9, EDA, SPRY2, SPRY4, and WNT10A as risk factors for MLIA. uncovered 3 strong synergistic interactions between MLIA liability and MSX1-TGFA, AXIN2-TGFA, and SPRY2-SPRY4 gene pairs. 1st evidence of sprouty genes in MLIA susceptibility. PMID:24554542
  37. TGFA polymorphism is associated with severity of acute otitis media. PMID:21440944
  38. In TGFA, associations between rs3771494, rs3771523 (G3822A), rs11466285 (T3851C) and non syndromic cleft lip/palate were observed in case-control and Family-based association analyses. PMID:23940636
  39. Our results suggested that LPS increases MUC5AC expression through the TACE/TGF-alpha/EGFR pathway in HIBECs. PMID:24027752
  40. Meta-analysis suggests that the C2 allele at TGFA/TaqI is a risk factor for cleft lip with/without cleft palate (CL/P). The A1 allele at TGFA/BamHI is protective against CL/P. No association was found between TGFA/RasI polymorphism and CL/P risk. PMID:24243742
  41. TGF-alpha-induced migration of cells may be partly due to upregulation of MMP-1. TGF-alpha and MMP-1 upregulation may contribute to the pathogenesis of chronic pancreatitis and pancreatic cancer. PMID:23608755
  42. skin neoplasms could be differentiated keratoacanthoma and squamous cell carcinoma based on staining patterns of TGF-alpha expression PMID:23697265
  43. TGFalpha, via multiple signaling pathways, regulates KGN cell proliferation and migration and may play an important role in the growth and metastasis of GCTs. PMID:23155381
  44. no evidence was found that TGFA/ Taq I polymorphisms play a role in clefting in southern Brazil and no evidence was found that tobacco or alcohol exposure during pregnancy was related to clefting PMID:22892881
  45. To explain the association of juvenile polyposis syndrome with Menetrier's disease we hypothesized a new mechanism that involves TGFbeta-SMAD4 pathway inactivation and TGFalpha overexpression related to Helicobacter pylori infection. PMID:22748914
  46. Interaction between IRF6 and TGFA genes contribute to the risk of nonsyndromic cleft lip/palate. PMID:23029012
  47. High TGF-alpha expression is associated with ovarian cancer. PMID:22914212
  48. Data suggest higher cord blood TGF-alpha and TGF-beta1 concentrations may represent a compensatory response to the inflammatory process characterizing the intrauterine-growth-restricted (IUGR) state. PMID:22732125
  49. The influence of transforming growth factor-alpha, cyclooxygenase-2, matrix metalloproteinase (MMP)-7, MMP-9 and CXCR4 proteins involved in epithelial-mesenchymal transition on overall survival of patients with gastric cancer. PMID:22582975
  50. concentrations in colostrum/milk remained at lower levels of below 1 ng/ml throughout the lactation period from days 1 to 30 PMID:22581387

Show More

Hide All

Subcellular Location
[Transforming growth factor alpha]: Secreted, extracellular space.; [Protransforming growth factor alpha]: Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines.
Database Links

HGNC: 11765

UNIGENE: Hs.170009

KEGG: hsa:7039

STRING: 9606.ENSP00000295400

OMIM: 190170

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products