Home
Product
Protein
Recombinant Proteins
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-10 (IL10),Baculovirus

Recombinant Macaca mulatta (Rhesus macaque) Interleukin-10 (IL10),Baculovirus

In Stock

Code: CSB-BP011580MOW

Rate （N/A）
Review （0）

Size:

20ug100ug1mg(1mg*1 or 500ug*2)

US$400

Quantity:

Express system: Baculovirus

Species: Macaca mulatta (Rhesus macaque)

Tag Info: N-terminal 10xHis-tagged and C-terminal myc-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

IL10

Uniprot NO.

P51496

Research Area

Others

Alternative Names

IL10Interleukin-10; IL-10; Cytokine synthesis inhibitory factor; CSIF

Species

Macaca mulatta (Rhesus macaque)

Source

Baculovirus

Expression Region

19-178aa

Target Protein Sequence

SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

22.7 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Tris-based buffer,50% glycerol

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Lead Time

3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

■ Q&A

Please can you provide information on which tagged form of the product we will receive and provide a predicted MWt for the protein including any tag. Also please confirm which tagged form is shown in the SDS-PAGE image.cccccx

Thanks for your inquiry. Tag information is N-terminal 10xHis-tagged and C-terminal myc-tagged.
Predicted MW (protein and tag) is 22.7 KD.
N-terminal 10xHis-tagged and C-terminal myc-tagged is shown in the SDS-PAGE.

Target Background

Function(From Uniprot)

Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptor comprising IL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation of STAT3. In turn, STAT3 translocates to the nucleus where it drives expression of anti-inflammatory mediators. Targets antigen-presenting cells (APCs) such as macrophages and monocytes and inhibits their release of pro-inflammatory cytokines including granulocyte-macrophage colony-stimulating factor /GM-CSF, granulocyte colony-stimulating factor/G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8 and TNF-alpha. Interferes also with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby inhibiting their ability to induce T cell activation. In addition, controls the inflammatory response of macrophages by reprogramming essential metabolic pathways including mTOR signaling.

Gene References into Functions

IL-10 produced during the immune response to malaria in this model contributes to suppression of mucosal inflammatory responses to invasive NTS, which may contribute to differences in the clinical presentation of NTS infection in the setting of malaria. PMID:24670425
Findings demonstrate that internalization of IL-10R with the resultant impact on IL-10 signaling and dysregulation of the IL-10-mediated anti-inflammatory responses might play a crucial role in epithelial cell damage and subsequent simian immunodeficiency virus pathogenesis. PMID:25165117
IL-10 plays a crucial role in maintaining mucosal homeostasis by regulating mucosal IFNgamma and TNFalpha cytokine production. PMID:23867612

Hide All

Subcellular Location

Secreted.

Protein Families

IL-10 family

Database Links

UNIGENE: Mmu.3374

KEGG: mcc:694931

STRING: 9544.ENSMMUP00000031022

Promotions