Home
Product
Protein
Recombinant Proteins
Recombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp)

Recombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp)

CSB-YP2069HIZ

Rate （N/A）
Review （0）

Size:

20ug100ug1mg(1mg*1 or 500ug*2)

US$436

Quantity:

Express system: Yeast

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Uniprot NO.

C5MKY7

Research Area

Microbiology

Source

Yeast

Expression Region

1-239aa

Target Protein Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Mol. Weight

30.9kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

Expand your microbiology research capabilities with our high-quality Recombinant Human Cytomegalovirus EGFP protein. This enhanced green fluorescent protein (EGFP) derived from Human cytomegalovirus (HHV-5) is an invaluable tool for visualizing cellular and viral processes, as well as monitoring gene expression and protein localization.

The full-length Recombinant Human Cytomegalovirus EGFP protein, expressed in yeast, encompasses the 1-239aa expression region, ensuring a robust and reliable performance in your experiments. Featuring both N-terminal 10xHis and C-terminal Myc tags, this protein can be efficiently purified and detected for precise results. With a purity of greater than 90% as determined by SDS-PAGE, our EGFP protein delivers consistent and dependable outcomes for your research needs. Available in both liquid and lyophilized powder forms, this versatile protein is ideal for a variety of experimental setups.