Abbreviation
Recombinant Human GCGR protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 μg/mL can bind Anti-GCGR recombinant antibody (CSB-RA009316A1HU), the EC50 is 3.747-6.666 ng/mL.
Alternative Names
GCGR; Glucagon receptor; GL-R
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
26-136aa
Target Protein Sequence
AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 μg/ml can bind Anti-GCGR recombinant antibody (CSB-RA009316A1HU), the EC50 is 3.747-6.666 ng/mL.
Description
The glucagon receptor's extracellular domain (residues 26–136) governs initial ligand recognition and represents the primary target for therapeutic antibodies in oncology-focused GCGR research. This partial recombinant human GCGR construct, expressed in mammalian cells to preserve native glycosylation and disulfide-mediated folding, delivers the ligand-binding domain with greater than 95% purity and endotoxin levels below 1.0 EU/μg, satisfying the quality thresholds commonly required for sensitive binding assays. Functional ELISA validation confirms robust activity, with immobilized GCGR (2 μg/mL) binding an anti-GCGR recombinant antibody at an EC50 of 3.747–6.666 ng/mL, providing a suitable basis for receptor-ligand interaction studies, competitive blocking antibody screening, and therapeutic antibody epitope mapping. Dual-tagged with an N-terminal 10×His and C-terminal Myc, this protein supports oriented immobilization for SPR or BLI affinity characterization and serves as a reliable positive control in binding assays.