Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
GLP-1 receptor
Short name:
GLP-1-R
Short name:
GLP-1R
Species
Homo sapiens (Human)
Expression Region
24-145aa
Target Protein Sequence
RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The fusion tag N-terminal 6xHis tag gene was added to the gene sequence corresponding to the mammalian cell of the human GLP1R protein to form the recombinant DNA. The recombinant DNA was cloned into the expression vector and then transfected into the mammalian cell for expression. Following purification, the product is the recombinant human GLP1R protein carrying N-terminal 6xHis tag. The SDS-PAGE assessed the purity of this recombinant GLP1R protein up to 90%. It had an apparent molecular weight of approximately 18 kDa. This recombinant GLP1R protein may find use in neuroscience research.
GLP1R is a gene presented on chromosome 6 providing instructions for making a protein called glucagon-like peptide 1 receptor in human and belongs to G-protein coupled receptor 2 family. GLP1R is a receptor protein expressed in beta cells of the pancreas and neurons of the brain. It is involved in the control of blood sugar level by enhancing insulin secretion. Studies have reported that GLP1R is a significant therapeutic target for small molecule drug discovery given the therapeutic impact of peptide agonists in the diabetes sphere.
