Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
Follicle stimulating hormone receptor; Follicle stimulating hormone receptor isoform 1; Follicle-stimulating hormone receptor; Follitropin receptor; FSH receptor; FSH-R; Fshr; FSHR_HUMAN; FSHRO; LGR1; MGC141667; MGC141668; ODG1; ovarian dysgenesis 1
Species
Homo sapiens (Human)
Expression Region
18-366aa
Target Protein Sequence
CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIMGYNILR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The gene encoding the Human FSHR protein (18-366aa) is inserted into a plasmid vector to form the recombinant plasmid, which is introduced into baculovirus cells. baculovirus cells that have successfully taken up the recombinant plasmid can be selected based on their ability to survive in the presence of a specific antibiotic. The recombinant plasmid-containing baculovirus cells are cultured under conditions that promote the expression of the interested gene. The protein is fused with a N-terminal 6xHis tag. After expression, the recombinant Human FSHR protein is isolated and purified from the cell lysate through affinity purification. The resulting recombinant Human FSHR protein is resolved by denaturing SDS-PAGE, allowing its purity to be estimated, greater than 85%.