Abbreviation
Recombinant Human EPO protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.3587-9.417 ng/mL.
Alternative Names
Erythropoietin; Epoetin
Species
Homo sapiens (Human)
Expression Region
28-193aa
Target Protein Sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.3587-9.417 ng/mL.
Description
Erythropoietin drives red blood cell production through high-affinity binding to EPOR on hematopoietic progenitors, and recombinant forms must retain native glycosylation to achieve physiological receptor engagement. This yeast-expressed protein, spanning the complete mature sequence (aa 28–193), demonstrates dose-dependent proliferation of TF-1 erythroleukemia cells with an ED50 of 0.3587–9.417 ng/mL, confirming receptor-binding competence suitable for cell proliferation assays, stem cell differentiation studies targeting erythroid lineages, and receptor-ligand competition experiments by ELISA or surface plasmon resonance. The yeast platform provides eukaryotic glycosylation machinery absent in bacterial systems, supporting post-translational modifications critical for EPO bioactivity. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in sensitive cell-based assays and antibody characterization workflows where contaminant interference must be minimized.
