Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
Abrineurin; ANON2; BDNF; BDNF_HUMAN; Brain Derived Neurotrophic Factor; Brain-derived neurotrophic factor; BULN2; MGC34632; Neurotrophin
Species
Homo sapiens (Human)
Expression Region
137-237aa
Target Protein Sequence
ELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSC
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Discover the potential of Brain-derived neurotrophic factor (BDNF) in your neuroscience research with our superior Recombinant Human BDNF protein. BDNF, also known as Abrineurin, is a neurotrophin that plays a crucial role in the survival, growth, and differentiation of neurons in the central and peripheral nervous systems. It is involved in synaptic plasticity, learning, memory, and neuronal regeneration, making it a vital protein for researchers in neurodegenerative diseases, neuropsychiatric disorders, and neural injury studies.
Our Recombinant Human BDNF protein is expressed in E. coli, ensuring a consistent and reliable product for your research needs. The partial protein length, covering the expression region from 137-237aa, retains the essential functional domains of BDNF. An N-terminal GST tag has been added to our recombinant BDNF protein to facilitate easy protein purification and detection. With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human BDNF protein is supplied as a lyophilized powder, providing you with a dependable and effective tool for your neuroscience research projects.
