Abbreviation
Recombinant Mouse Gipr protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Gipr at 2 μg/mL can bind Anti-Mouse Gipr Recombinant Antibody (CSB-RA009438MA1MO), the EC50 is 8.622-11.36 ng/ml.
Alternative Names
Gastric inhibitory polypeptide receptor;GIP-R;Glucose-dependent insulinotropic polypeptide receptor;Gipr
Species
Mus musculus (Mouse)
Expression Region
19-134aa
Target Protein Sequence
ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Gipr at 2μg/mL can bind Anti-Mouse Gipr recombinant antibody (CSB-RA009438MA1MO)， the EC50 is 8.622-11.36 ng/mL.
Description
Gastric inhibitory polypeptide receptor plays a central role in glucose homeostasis and energy metabolism, making its extracellular domain a key target for therapeutic antibody development in obesity and metabolic disease research. This partial construct spanning residues 19–134 captures the ligand-binding region and demonstrates quantifiable binding activity in functional ELISA, where immobilized protein at 2 μg/mL binds an anti-Gipr recombinant antibody with an EC50 of 8.622–11.36 ng/mL—a result that supports its use in competitive inhibition assays, blocking antibody screening, and therapeutic antibody epitope mapping. Mammalian expression preserves native glycosylation and disulfide bond formation critical for conformational integrity in receptor-ligand interaction studies, including surface plasmon resonance and biolayer interferometry experiments. The protein meets quality thresholds commonly required for drug discovery applications, with greater than 95% purity by SDS-PAGE and endotoxin levels below 1.0 EU/μg, providing a suitable basis for small-molecule or biologic inhibitor screening platforms.
