Abbreviation
Recombinant Human EPO protein (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
①The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.3534 to 0.7096 ng/mL.
②Measured by its binding ability in a functional ELISA.Immobilized Human EPO at 2 μg/mL can bind Anti-EPO recombinant antibody (CSB-RA007743MA1HU).The EC50 is 0.4354-0.5532 ng/mL.
Alternative Names
Erythropoietin; Epoetin
Species
Homo sapiens (Human)
Expression Region
28-193aa
Target Protein Sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.3534 to 0.7096 ng/mL.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human EPO at 2 μg/mL can bind Anti-EPO recombinant antibody (CSB-RA007743MA1HU).The EC50 is 0.4354-0.5532 ng/mL.
Description
Erythropoietin drives red blood cell production by binding the EPO receptor on erythroid progenitors, and recombinant forms with authentic glycosylation are essential for assays that depend on receptor engagement and downstream signaling. This mammalian-expressed protein, spanning the full mature sequence (aa 28–193), demonstrates dose-dependent proliferation of TF-1 cells with an ED50 of 0.35–0.71 ng/mL, confirming receptor-mediated bioactivity suitable for cell survival assays and hematopoietic differentiation studies. The same preparation binds an anti-EPO recombinant antibody in functional ELISA with an EC50 of 0.44–0.55 ng/mL, supporting its use in receptor-ligand competition assays, antibody characterization panels, and as a quantitative ELISA standard. Purity exceeding 90% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in sensitive proliferation and binding experiments where contaminants can confound dose-response curves.