Recombinant Human Interleukin-7 (IL7) (Active)

In Stock
Code: CSB-AP004441HU
Size:
10ug
10ug50ug500ug1mg
US$290
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: Tag-Free
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human IL7 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is 0.02-0.08 ng/ml.
Uniprot NO.
Research Area
Immunology
Alternative Names
IL7; Interleukin-7; IL-7
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
26-177aa
Target Protein Sequence
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20mM PB, 300mM NaCl, pH 8.0.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

IL-7 is a critical homeostatic cytokine governing T-cell survival, proliferation, and thymic development through JAK1/JAK3–STAT5 signaling. This tag-free recombinant human IL-7, encompassing the full mature sequence (aa 26–177) produced in *E. coli*, demonstrates exceptional signaling potency with an ED50 of 0.02–0.08 ng/mL in PHA-activated human peripheral blood lymphocyte proliferation assays, confirming its suitability for T-cell and B-cell functional studies, lymphocyte differentiation experiments, and JAK/STAT pathway activation analyses. Endotoxin levels below 1.0 EU/μg eliminate LPS-driven artifacts that confound immune cell assays, making this preparation appropriate for in vivo models of infection or tumor immunology, as well as serving as a reference standard in cytokine detection platforms such as ELISA. Purity exceeding 95% by SDS-PAGE, combined with this stringent endotoxin control, supports use in antibody development workflows including immunization, coating antigen preparation, and positive control applications.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
Gene References into Functions
  1. Human IL-7 binds more strongly to stretched than to relaxed Fibronectin. PMID:28845674
  2. Downregulation of IL-7 and T follicular helper cells (Tfh) might contribute to viral persistence in hepatitis C virus (HCV)infection. The in vitro study revealed an immunopotentiator of IL-7 in chronic HCV infection, which manifested as IL-7-regulated HCV-specific and nonspecific activated Tfh cells. PMID:29672235
  3. These data indicate the involvement of IL-7 into a direct upregulation of growth and functional activity of human T cells in the absence of antigenic stimulus and the relative scarcity of costimulatory effects. PMID:30193429
  4. these findings add further evidence that IL-7 is a key regulatory factor that may tune the balance between functionally different T-cell subsets following haematopoietic stem cell transplantation PMID:29033080
  5. The constitutively signaling C7R system developed here delivers potent IL7 stimulation to CAR T cells, increasing their persistence and antitumor activity against multiple preclinical tumor models, supporting its clinical development PMID:28830878
  6. we demonstrated that Imatinib mesylate (IM)impaired T cell survival through the inhibition of IL-7 and STAT5-p but not TCR signaling which remained unaffected during IM therapy. Thus, off-target inhibitory effects of IM on IL-7 and STAT5-p explain how T cell lymphopenia occurs in patients treated with IM. PMID:28387753
  7. In this study, authors compared the concentrations of IL-15 and IL-7 in the plasma of MDS patients (n = 20) compared with that in the plasma of healthy controls (n = 20). PMID:27036031
  8. Data strongly implicate IL-7 in the thymus-independent long-term survival of functional naive-Tregs. PMID:26910841
  9. the critical role played by IL-7 and IL-15 in T cell homeostasis and how these cytokines could be used to improve immune reconstitution after allogeneic SCT. PMID:26795458
  10. IL-7/IL-7R signaling pathway plays a possible role in recurrent pregnancy loss by upregulating Th17 immunity while downregulating Treg immunity. PMID:27767237
  11. IL-7 inhibits the osteogenic differentiation of Periodontal ligament stem cells probably via inactivation of mitogen-activated protein kinase (MAPK) signaling pathway. PMID:27579861
  12. this study shows that IL-7 restores T Lymphocyte immunometabolic failure in septic shock patients through mTOR activation PMID:28724580
  13. In CRC, IL-7 was higher in patients with lymph node and distant metastases and with tumors located in right colon. In adenomas, IL-7 elevation was associated exclusively with villous growth pattern, while in IBD, circulating IL-7 reflected clinical activity of Crohn's disease and ulcerative colitis. PMID:27866242
  14. Tuberculosis patients had lower soluble IL-7R and higher IL-7 plasma concentrations as compared to healthy contacts. PMID:28582466
  15. CD56(bright) NK IL-7Ralpha expression negatively associates with HCV level, and IL-7-induced NK function is impaired during HCV and HIV infections PMID:28400540
  16. IL-7 has a role inducing epitope masking of gammac protein in IL-7 receptor signaling complex PMID:28127156
  17. Therefore, generalized CD8+ T-cell impairment in HCV infection is characterized, in part, by impaired IL-7-mediated signalling and survival, independent of CD127 expression. This impairment is more pronounced in the liver and may be associated with an increased potential for apoptosis. This generalized CD8+ T-cell impairment represents an important immune dysfunction in chronic HCV infection that may alter patient health. PMID:27315061
  18. These results reveal a novel role of IL-7 and IL-15 in maintaining human T cell function, provide an explanation for T cell dysfunction in humanized mice, and have significant implications for in vitro studies with human T cells. PMID:27855183
  19. The results show that SNPs in IL7 caused a significant association in this OA Chinese Han population. PMID:27235388
  20. IL-7 is capable of enhancing functional T cell activity without causing significant functional inbalance between various T cell subsets. PMID:28396296
  21. In summary, our study demonstrates that IL-7/IL-7R axis promotes the invasion and migration of prostate cancer cells, through activation of AKT/NF-kappaB pathway and upregulation of MMP-3 and MMP-7 expression PMID:27611862
  22. review of role of IL-7 in immunity and its role in the pathogenesis of neoplasia [review] PMID:28314253
  23. Indian patients with primary Sjogren's syndrome have higher salivary sL-selectin and IL-7 levels than healthy controls PMID:27620619
  24. increased IL-7 was secreted by mesenchymal stem cells (MSC) in the bone marrow, which may protect leukemic cells from apoptosis induced by imatinib through JAK1/STAT5 signaling pathway PMID:27272942
  25. The results from this study suggested for the first time that miR-181c was able to negatively regulate the production of proinflammatory cytokines IL-7 and IL-17 in myasthenia gravis patients. PMID:25962782
  26. Increase in serum IL-7 is associated with adenoma. PMID:25793917
  27. provides negative feedback on its own signaling in T cells via endocytosis and degradation of its receptor, CD127 PMID:26272555
  28. Observed highly significant reductions in the concentration of circulating interleukin (IL)-16, IL-7, and Vascular Endothelial Growth Factor A (VEGF-A) in encephalomyelitis/chronic fatigue syndrome patients. PMID:26615570
  29. The observations suggest that IL-7 may play a role in the pathogenesis of Graves' disease and may be associated with its clinical activity. PMID:26113403
  30. IL-7 and SCF are elevated for a prolonged period after double umbilical cord blood transplantation and persistently high levels of these cytokines may correlate with worse clinical outcomes. PMID:26177551
  31. IL7 was expressed primarily in the infundibulum and suprabulb of the hair follicle. IL7 expression was increased in cutaneous T-cell lymphoma. PMID:26479922
  32. this study identified that IL-7, as well as the Akt/ mTOR signaling pathway, effectively modulates human Double-Negative T Cell- mediated suppression of allogeneic T cell responses. PMID:26324773
  33. IL-7/IL-17 axis mediates chronic pelvic pain in experimental autoimmune prostatitis and in patients. PMID:25933188
  34. In view of the important role IL-7 plays in lymphocyte proliferation, homeostasis and survival, down regulation of CD127 by Tat likely plays a central role in immune dysregulation and CD4 T-cell decline PMID:25333710
  35. decreased IL-7 in peripheral blood, maybe, is a consequence of the negative feedback of the pro-inflammatory function in ITP patients. PMID:24750122
  36. Septic patients showed the lowest levels of IL-7. Patients with severe sepsis reached levels of IL-7 higher than those observed in the groups of uncomplicated sepsis and septic shock. PMID:25169828
  37. These observations provide evidence of a novel mechanism that enables cells to optimally use IL-7. PMID:25870237
  38. blocking IL-7 in hMSCs-lymphocytes co-cultures increased lymphocytes apoptosis and we also have demonstrated that hMSCs are able to produce this interleukin PMID:25184791
  39. The present data indicate that high plasma levels of IL-7 in the early post-transplant period are predictive for slow T cell reconstitution, increased risk of acute graft-versus-host disease and increased mortality following haematopoietic stem cell transplantation. PMID:25263171
  40. IL-7 elevates miR-124 to decrease the expression of splicing regulator PTB and represses CD95 mRNA splicing. PMID:25411246
  41. These results strongly suggest that IL-7/IL-7R prevents apoptosis by upregulating the expression of bcl-2 and by downregulating the expression of bax PMID:24695377
  42. These data suggest that increased IFN-alpha activity may promote the loss of T cells by accelerating cell turnover and activation-induced cell death while decreasing the renewal of T cells by inhibiting the proliferative effect of IL-7. PMID:25063872
  43. Diminished T-cell responsiveness to IL-7. PMID:24585897
  44. Low-level transient antigenic stimuli during cART were not associated with changes in the thymic function or the IL-7/CD127 system. PMID:24820104
  45. IL-7 can have a significant impact in sustaining expansion and persistence of adoptively chimeric antigen receptor-redirected cytotoxic T lymphocytes. PMID:24097874
  46. IL-23 does not induce IL-7 expression in microglia and astrocytes. PMID:24224652
  47. Changes of IL-7 expression in different phases of Graves ophthalmopathy (GO) suggested that IL-7 may play an important role in the pathogenesis of GO. PMID:23188693
  48. These results suggest that ineffective responses to IL-7 could impair the transition to memory cells of naive CD4(+) T lymphocytes recognizing self-peptides in the setting of strong costimulation. PMID:23454917
  49. our data point toward an unexpected new role for IL-7 as a potential autocrine mediator of lymphatic drainage PMID:23963040
  50. our data show that IL-7 negatively regulates Tregs PMID:23966629

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-7/IL-9 family
Database Links

HGNC: 6023

UNIGENE: Hs.591873

KEGG: hsa:3574

STRING: 9606.ENSP00000263851

OMIM: 146660

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products