Abbreviation
Recombinant Human IL7 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is 0.02-0.08 ng/ml.
Alternative Names
IL7; Interleukin-7; IL-7
Species
Homo sapiens (Human)
Expression Region
26-177aa
Target Protein Sequence
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20mM PB, 300mM NaCl, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
IL-7 is a critical homeostatic cytokine governing T-cell survival, proliferation, and thymic development through JAK1/JAK3–STAT5 signaling. This tag-free recombinant human IL-7, encompassing the full mature sequence (aa 26–177) produced in *E. coli*, demonstrates exceptional signaling potency with an ED50 of 0.02–0.08 ng/mL in PHA-activated human peripheral blood lymphocyte proliferation assays, confirming its suitability for T-cell and B-cell functional studies, lymphocyte differentiation experiments, and JAK/STAT pathway activation analyses. Endotoxin levels below 1.0 EU/μg eliminate LPS-driven artifacts that confound immune cell assays, making this preparation appropriate for in vivo models of infection or tumor immunology, as well as serving as a reference standard in cytokine detection platforms such as ELISA. Purity exceeding 95% by SDS-PAGE, combined with this stringent endotoxin control, supports use in antibody development workflows including immunization, coating antigen preparation, and positive control applications.