Abbreviation
Recombinant Human EGF protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 60-450 pg/ml.
Research Area
Signal Transduction
Alternative Names
Beta urogastrone; beta-urogastrone; EGF; EGF_HUMAN; Epidermal growth factor; HOMG4; OTTHUMP00000219721; OTTHUMP00000219722; Pro epidermal growth factor; URG; Urogastrone
Species
Homo sapiens (Human)
Expression Region
971-1023aa
Target Protein Sequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 200 mM NaCl, pH 8
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
This tag-free recombinant human EGF fragment (residues 971–1023) demonstrates potent mitogenic activity with an ED50 of 60–450 pg/mL in BALB/c 3T3 cell proliferation assays, confirming robust EGFR-binding competence suitable for dose-response and receptor-ligand competition studies via ELISA or SPR. The 53-amino-acid sequence corresponds to the mature, processed EGF domain, and its E. coli expression yields a non-glycosylated form that provides a defined, homogeneous ligand—eliminating glycan-related variability that can confound quantitative binding kinetics. This protein supports use in wound healing scratch assays, stem cell maintenance or differentiation protocols, and as a calibration standard for antibody characterization experiments. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based bioassays and in vivo tumor biology models where endotoxin interference must be minimized.