Abbreviation
Recombinant Human IGF1 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.5 EU/µg as determined by LAL method.
Activity
The ED50 as determined in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells is 20-100 ng/ml.
Research Area
Signal Transduction
Alternative Names
IBP1; IGF I; IGF IA; IGF IB; IGF-I; Igf1; IGF1_HUMAN; IGF1A; IGFI; IGFIA; Insulin like growth factor 1 (somatomedin C) ; Insulin like growth factor 1; Insulin like growth factor IA; Insulin like growth factor IB; Insulin-like growth factor I; Mechano growth factor; MGF; OTTHUMP00000195080; OTTHUMP00000195081; OTTHUMP00000195082; OTTHUMP00000195083; OTTHUMP00000195084; Somatomedia C; Somatomedin C; Somatomedin-C
Species
Homo sapiens (Human)
Expression Region
52-118aa
Target Protein Sequence
TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm Filtered 20 mM NaAc-HAC, pH 4.5
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Datasheet & COA
Please contact us to get it.
Description
IGF1 plays a central role in mitogenic signaling through the IGF1R axis, making reliable recombinant preparations essential for dissecting proliferation and survival pathways. This tag-free human IGF1 partial construct, spanning residues 52–118 and representing the mature bioactive sequence, demonstrates an ED50 of 20–100 ng/mL in a serum-free MCF-7 cell proliferation assay, confirming receptor-binding potency suitable for cell proliferation and survival studies, stem cell or osteogenic differentiation protocols, and receptor-ligand competition assays using ELISA or SPR. Production in *E. coli* is well-matched to IGF1's biology, as the native protein lacks glycosylation, ensuring that bacterially expressed material retains full functional fidelity without the need for mammalian post-translational processing. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 0.5 EU/µg satisfies the criteria typical for serum-free cell-based assays and supports use in sensitive in vivo tumor biology models.
